DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mod and Ncl

DIOPT Version :9

Sequence 1:NP_001247401.1 Gene:mod / 43764 FlyBaseID:FBgn0002780 Length:542 Species:Drosophila melanogaster
Sequence 2:NP_035010.3 Gene:Ncl / 17975 MGIID:97286 Length:707 Species:Mus musculus


Alignment Length:649 Identity:157/649 - (24%)
Similarity:255/649 - (39%) Gaps:160/649 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KKAVTVKGKKATNGEEKPLAKRVTKSTKV--------QEEETVVPQSPSKKSRKQPVKEVPQFSE 60
            |||....||||.   ..|..|.:|.:..:        .:.:.:|| :|.||....|.|.......
Mouse    79 KKAAVTPGKKAV---ATPAKKNITPAKVIPTPGKKGAAQAKALVP-TPGKKGAATPAKGAKNGKN 139

  Fly    61 EDESDVEEQNDEQPGDDSD----------FETEEAAGL---------------IDDEAEEDEEYN 100
            ..:.|.:|..||:..||||          ||.....|:               .|||.|:|||  
Mouse   140 AKKEDSDEDEDEEDEDDSDEDEDDEEEDEFEPPIVKGVKPAKAAPAAPASEDEEDDEDEDDEE-- 202

  Fly   101 SDDEEDDDDDELEPGEVSKSEGA--------------------------------DEVDESDDDE 133
            .||||::||.|.|..|::.::|.                                :|.|:.||||
Mouse   203 DDDEEEEDDSEEEVMEITTAKGKKTPAKVVPMKAKSVAEEEDDEEEDEDDEDEDDEEEDDEDDDE 267

  Fly   134 EAPVEKPVSKKSEKANSEKSEENRGIPKVKVGKI----PLGTPKNQIVFVTNL-PNEYLHK---D 190
            |...|:||.....|...|.:::... |:.|..|:    |. ||.|  :|:.|| ||:.:::   .
Mouse   268 EEEEEEPVKAAPGKRKKEMTKQKEA-PEAKKQKVEGSEPT-TPFN--LFIGNLNPNKSVNELKFA 328

  Fly   191 LVALFAKFGRLSALQRFTNLNGNKSVLIAFDTSTGAEAVLQAKPKALTLGDNVLSVSQPRNKEEN 255
            :..|||| ..|:.:...|..| .|...:.|:::...|..|:.  ..|.:..|.:.:.:|:.::..
Mouse   329 ISELFAK-NDLAVVDVRTGTN-RKFGYVDFESAEDLEKALEL--TGLKVFGNEIKLEKPKGRDSK 389

  Fly   256 N---ERTVVVGLIGPNITKDDLKTFFEKVAPVEAVTISSNRLMPRAFVRLASVDDIPKAL-KLHS 316
            .   .||::...:..|||:|:||..||....:..|: ...:....|::...|..|..|.| :...
Mouse   390 KVRAARTLLAKNLSFNITEDELKEVFEDAMEIRLVS-QDGKSKGIAYIEFKSEADAEKNLEEKQG 453

  Fly   317 TELFSRFITV-----RRISQESISRTS-----ELTLVVENVGKHESYSS--DALEKIFKK--FGD 367
            .|:..|.:::     :...||...:||     ..|||:.|:    |||:  :.||::|:|  |..
Mouse   454 AEIDGRSVSLYYTGEKGQRQERTGKTSTWSGESKTLVLSNL----SYSATKETLEEVFEKATFIK 514

  Fly   368 VEEIDVVCSKAVLAFVTFKQSDAATKAL-----AQLDGKTVNKFEWKLHRFE------RSTSGRA 421
            |.:......|. .||:.|...:.|.:||     .:::|:|:        |.|      ||...:.
Mouse   515 VPQNPHGKPKG-YAFIEFASFEDAKEALNSCNKMEIEGRTI--------RLELQGSNSRSQPSKT 570

  Fly   422 ILVTNLTSDATEADLRKVFNDSGEIESIIMLGQKAVVKFKDDEGFCKSFLANESIVNNAPIFIEP 486
            :.|..|:.|.||..|::.|  .|.:.:.|:..:        :.|..|.|           .|::.
Mouse   571 LFVKGLSEDTTEETLKESF--EGSVRARIVTDR--------ETGSSKGF-----------GFVDF 614

  Fly   487 NSLLKHRLLKKRLAIGQTRAPRKFQKDTKP---------NFGKKPFNKRPAQENGGKSFVKRAR 541
            ||....:..|:.:..|:....:......||         ..|:..|..|.....|...|..|.|
Mouse   615 NSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGEGGFGGRGGGRGGFGGRGGGRGGRGGFGGRGR 678

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modNP_001247401.1 RRM_SF 177..244 CDD:302621 18/70 (26%)
RRM_SF 260..327 CDD:240668 16/72 (22%)
RRM_SF 342..411 CDD:240668 21/77 (27%)
RRM_SF 422..>465 CDD:302621 9/42 (21%)
NclNP_035010.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..308 61/236 (26%)
8 X 8 AA tandem repeats of X-T-P-X-K-K-X-X 58..135 17/59 (29%)
RRM1_NCL 309..383 CDD:240849 19/79 (24%)
RRM2_NCL 392..467 CDD:240850 18/75 (24%)
RRM3_NCL 486..558 CDD:240851 23/84 (27%)
RRM4_NCL 569..646 CDD:240852 19/97 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 639..707 9/40 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.