DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mod and PABPC4L

DIOPT Version :9

Sequence 1:NP_001247401.1 Gene:mod / 43764 FlyBaseID:FBgn0002780 Length:542 Species:Drosophila melanogaster
Sequence 2:NP_001108206.3 Gene:PABPC4L / 132430 HGNCID:31955 Length:370 Species:Homo sapiens


Alignment Length:258 Identity:52/258 - (20%)
Similarity:108/258 - (41%) Gaps:35/258 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 VFVTNLPNEYLHKDLVALFAKFGRLSALQRFTNLNGNKS-VLIAFDTSTGAEAVLQAKPKALTLG 240
            ||:.||.....:|.|...|:.||::.:.:..::..|:|. ..:.|...:.|:..::.....|..|
Human   100 VFIKNLDKSIDNKTLYEHFSAFGKILSSKVMSDDQGSKGYAFVHFQNQSAADRAIEEMNGKLLKG 164

  Fly   241 DNVLSVSQPRNKEENNER---------TVVVGLIGPNITKDDLKTFFE---KVAPVEAVTISSNR 293
            ..|. |.:.:|:::....         .|.:...|.::..:.||..|.   |...|:.:|.||.:
Human   165 CKVF-VGRFKNRKDREAELRSKASEFTNVYIKNFGGDMDDERLKDVFSKYGKTLSVKVMTDSSGK 228

  Fly   294 LMPRAFVRLASVDDIPKAL-KLHSTELFSRFITVRRISQESISRTSELTLVVENVGKH------- 350
            .....||...|.:...||: :::..::..:.|.|.| :|:.:.|.:||..:.|.:.:.       
Human   229 SKGFGFVSFDSHEAAKKAVEEMNGRDINGQLIFVGR-AQKKVERQAELKQMFEQLKRERIRGCQG 292

  Fly   351 ---------ESYSSDALEKIFKKFGDVEEIDVVCSKAV---LAFVTFKQSDAATKALAQLDGK 401
                     ::...:.|...|..||.:..:.|:..:..   ...:.|...:.||||:.:::|:
Human   293 VKLYIKNLDDTIDDEKLRNEFSSFGSISRVKVMQEEGQSKGFGLICFSSPEDATKAMTEMNGR 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modNP_001247401.1 RRM_SF 177..244 CDD:302621 15/67 (22%)
RRM_SF 260..327 CDD:240668 16/70 (23%)
RRM_SF 342..411 CDD:240668 12/79 (15%)
RRM_SF 422..>465 CDD:302621
PABPC4LNP_001108206.3 RRM 10..>369 CDD:330708 52/258 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.