DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2053 and CNOT9

DIOPT Version :9

Sequence 1:NP_001287632.1 Gene:CG2053 / 43762 FlyBaseID:FBgn0039887 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_001258563.1 Gene:CNOT9 / 9125 HGNCID:10445 Length:331 Species:Homo sapiens


Alignment Length:307 Identity:108/307 - (35%)
Similarity:165/307 - (53%) Gaps:34/307 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DIDSVFGWIANLCNKETRLWAMLELFERRTHIDSLGLLLWHSFGAVSGLLQEIVSIYPAIYQEIE 77
            |.:.::.||..|.:.|||..|:|||.::|..:..|..:||||||.::.||||||:|||:| ....
Human    18 DREKIYQWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSI-NPPT 81

  Fly    78 LTGQQSHRICTAIGLIQAMASHPFIGIQLIRCQFMCYLMPLLKMTSQTRAVEHVRLSVLGVIC-- 140
            ||..||:|:|.|:.|:|.:||||......:......:|.|.|...|:||..|::||:.||||.  
Human    82 LTAHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVIVET 146

  Fly   141 ------------------------------GLLKSDHPEIVSYFLGTELIPLTLRQLEFGTTMSK 175
                                          .|:|:|..|::::.|.||:|||.||.:|.|:.:||
Human   147 GFHHVGQADLELPTSSDLPASASQSAGITGALVKTDEQEVINFLLTTEIIPLCLRIMESGSELSK 211

  Fly   176 VLCAFVLYRTLEHEVGLKFASRRLARKLHLIHTLARVVHQLTLEPEPRVLKHVVRIYSRLADHPQ 240
            .:..|:|.:.|..:.||.:..:...|..|:...|.::|.||:.||..|:||||||.|.||:|:|:
Human   212 TVATFILQKILLDDTGLAYICQTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNPR 276

  Fly   241 NLELILKLLPAQIRNGYFCQEGLVGFESASLELADLNRKLSKNEEKD 287
            ..|.:.:.||.|:::..|.|. |....:....||.|.:.|.:.:..|
Human   277 AREALRQCLPDQLKDTTFAQV-LKDDTTTKRWLAQLVKNLQEGQVTD 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2053NP_001287632.1 Rcd1 28..258 CDD:281998 96/261 (37%)
CNOT9NP_001258563.1 Rcd1 33..315 CDD:281998 102/283 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5209
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53719
OrthoDB 1 1.010 - - D1129961at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12262
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.