DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2053 and AT5G12980

DIOPT Version :9

Sequence 1:NP_001287632.1 Gene:CG2053 / 43762 FlyBaseID:FBgn0039887 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_196802.1 Gene:AT5G12980 / 831138 AraportID:AT5G12980 Length:311 Species:Arabidopsis thaliana


Alignment Length:257 Identity:90/257 - (35%)
Similarity:143/257 - (55%) Gaps:1/257 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SAPNMDCEQRGDIDSVFGWIANLCNKETRLWAMLELFERRTHIDSLGLLLWHSFGAVSGLLQEIV 66
            |:|:........:.|....|.:|.|.|.|..|:.||.::|.....|..|||||.|.:..|||||:
plant    19 SSPSSSSNNDRKLSSAEQLILDLSNPELRENALHELSKKREIFQDLAPLLWHSVGTIPALLQEII 83

  Fly    67 SIYPAIYQEIELTGQQSHRICTAIGLIQAMASHPFIGIQLIRCQFMCYLMPLLKMTSQTRAVEHV 131
            ::|||: ....:|..||:|:|.|:.|:|.:|||....:..::.....||...|..:|::|..|::
plant    84 AVYPAL-SPPTMTPAQSNRVCNALALLQCVASHTDTRMLFLKAHLPLYLYAFLNTSSKSRPFEYL 147

  Fly   132 RLSVLGVICGLLKSDHPEIVSYFLGTELIPLTLRQLEFGTTMSKVLCAFVLYRTLEHEVGLKFAS 196
            ||:.||||..|:|.|..|::.:.|.||::||.||.:|.|:.:||.:..|::.:.|..:|||::..
plant   148 RLTSLGVIGALVKVDDTEVIRFLLQTEIVPLCLRTMENGSELSKTVATFIVQKVLLDDVGLEYMC 212

  Fly   197 RRLARKLHLIHTLARVVHQLTLEPEPRVLKHVVRIYSRLADHPQNLELILKLLPAQIRNGYF 258
            ....|...|...|..:|..|...|..|:|||::|.|.||.|:|:..:.:...||..:|:..|
plant   213 TTAERFFALGRVLGNMVTSLAEGPSARLLKHIIRCYLRLTDNPRACDALGSCLPDLLRDATF 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2053NP_001287632.1 Rcd1 28..258 CDD:281998 83/229 (36%)
AT5G12980NP_196802.1 Rcd1 37..295 CDD:397961 87/239 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5209
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53719
OrthoDB 1 1.010 - - D1129961at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12262
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.890

Return to query results.
Submit another query.