DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2053 and AT3G20800

DIOPT Version :9

Sequence 1:NP_001287632.1 Gene:CG2053 / 43762 FlyBaseID:FBgn0039887 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_188716.1 Gene:AT3G20800 / 821628 AraportID:AT3G20800 Length:316 Species:Arabidopsis thaliana


Alignment Length:238 Identity:92/238 - (38%)
Similarity:143/238 - (60%) Gaps:1/238 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 IANLCNKETRLWAMLELFERRTHIDSLGLLLWHSFGAVSGLLQEIVSIYPAIYQEIELTGQQSHR 85
            :.:|.|.|.|..|:|||.::|.....|..|||:|||.::.||||||||| ::.....||..||:|
plant    42 VLDLSNPELRENALLELSKKRELFQDLAPLLWNSFGTIAALLQEIVSIY-SVLAPPNLTPAQSNR 105

  Fly    86 ICTAIGLIQAMASHPFIGIQLIRCQFMCYLMPLLKMTSQTRAVEHVRLSVLGVICGLLKSDHPEI 150
            :|.::.|:|.:|||....:..::.....||.|.|..||::|..|::||:.||||..|:|.|..|:
plant   106 VCNSLALLQCVASHSDTRMLFLKAHIPLYLYPFLNTTSKSRPFEYLRLTSLGVIGALVKVDDTEV 170

  Fly   151 VSYFLGTELIPLTLRQLEFGTTMSKVLCAFVLYRTLEHEVGLKFASRRLARKLHLIHTLARVVHQ 215
            :|:.|.||:|||.||.:|.|:.:||.:..|::.:.|..:||:.:......|...:...|..:|..
plant   171 ISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGMDYICTTAERFFAVGRVLGNMVQS 235

  Fly   216 LTLEPEPRVLKHVVRIYSRLADHPQNLELILKLLPAQIRNGYF 258
            |..:|.||:|||::|.|.||:|:|:....:...||..:|:|.|
plant   236 LVEQPSPRLLKHIIRCYLRLSDNPRACAALASCLPDSLRDGSF 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2053NP_001287632.1 Rcd1 28..258 CDD:281998 89/229 (39%)
AT3G20800NP_188716.1 Rcd1 41..299 CDD:397961 92/238 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5209
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53719
OrthoDB 1 1.010 - - D1129961at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12262
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.890

Return to query results.
Submit another query.