DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2053 and cnot9

DIOPT Version :9

Sequence 1:NP_001287632.1 Gene:CG2053 / 43762 FlyBaseID:FBgn0039887 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_999925.1 Gene:cnot9 / 406632 ZFINID:ZDB-GENE-030131-1558 Length:298 Species:Danio rerio


Alignment Length:275 Identity:105/275 - (38%)
Similarity:162/275 - (58%) Gaps:2/275 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DIDSVFGWIANLCNKETRLWAMLELFERRTHIDSLGLLLWHSFGAVSGLLQEIVSIYPAIYQEIE 77
            |.:.::.||..|.:.|||..|:|||.::|..:..|..:||||.|.::.||||||:|||:| ....
Zfish    17 DREKIYQWINELSSPETRENALLELSKKRESVTDLAPMLWHSCGTIAALLQEIVNIYPSI-NPPT 80

  Fly    78 LTGQQSHRICTAIGLIQAMASHPFIGIQLIRCQFMCYLMPLLKMTSQTRAVEHVRLSVLGVICGL 142
            ||..||:|:|.|:.|:|.:|||.......:......:|.|.|...|:||..|::||:.||||..|
Zfish    81 LTAHQSNRVCNALALLQCVASHVETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVIGAL 145

  Fly   143 LKSDHPEIVSYFLGTELIPLTLRQLEFGTTMSKVLCAFVLYRTLEHEVGLKFASRRLARKLHLIH 207
            :|:|..|::::.|.||:|||.||.:|.|:.:||.:..|:|.:.|..:.||.:..:...|..|:..
Zfish   146 VKTDEQEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYICQTYERFSHVAM 210

  Fly   208 TLARVVHQLTLEPEPRVLKHVVRIYSRLADHPQNLELILKLLPAQIRNGYFCQEGLVGFESASLE 272
            .|.::|.||:.||..|:||||||.|.||:|:.:..|.:.:.||.|:::..|.|. |....:....
Zfish   211 ILGKMVLQLSKEPSARLLKHVVRCYLRLSDNSRAREALRQCLPDQLKDTTFAQV-LKDDSTTKRW 274

  Fly   273 LADLNRKLSKNEEKD 287
            ||.|.:.|.:.:..|
Zfish   275 LAQLVKNLQEGQVTD 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2053NP_001287632.1 Rcd1 28..258 CDD:281998 93/229 (41%)
cnot9NP_999925.1 Rcd1 32..282 CDD:281998 99/251 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53719
OrthoDB 1 1.010 - - D1129961at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12262
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.