DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2053 and Cnot9

DIOPT Version :9

Sequence 1:NP_001287632.1 Gene:CG2053 / 43762 FlyBaseID:FBgn0039887 Length:298 Species:Drosophila melanogaster
Sequence 2:XP_038939282.1 Gene:Cnot9 / 301513 RGDID:1311495 Length:300 Species:Rattus norvegicus


Alignment Length:276 Identity:108/276 - (39%)
Similarity:164/276 - (59%) Gaps:3/276 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DIDSVFGWIANLCNKETRLWAMLELFERRTHIDSLGLLLWHSFGAVSGLLQEIVSIYPAIYQEIE 77
            |.:.::.||..|.:.|||..|:|||.::|..:..|..:||||||.::.||||||:|||:| ....
  Rat    18 DREKIYQWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSI-NPPT 81

  Fly    78 LTGQQSHRICTAIGLIQAMASHPFIGIQLIRCQFMCYLMPLLKMTSQTRAVEHVRLSVLGVICGL 142
            ||..||:|:|.|:.|:|.:||||......:......:|.|.|...|:||..|::||:.||||..|
  Rat    82 LTAHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVIGAL 146

  Fly   143 LKSDHPEIVSYFLGTELIPLTLRQLEFGTTMSKVLCAFVLYRTLEHEVGLKFASRRLARKLHLIH 207
            :|:|..|::::.|.||:|||.||.:|.|:.:||.:..|:|.:.|..:.||.:..:...|..|:..
  Rat   147 VKTDEQEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYICQTYERFSHVAM 211

  Fly   208 TLARVVHQLTLEPEPRVLKHVVRIYSRLADHPQNL-ELILKLLPAQIRNGYFCQEGLVGFESASL 271
            .|.::|.||:.||..|:||||||.|.||:|:|... |.:.:.||.|:::..|.|. |....:...
  Rat   212 ILGKMVLQLSKEPSARLLKHVVRCYLRLSDNPSRAREALRQCLPDQLKDTTFAQV-LKDDTTTKR 275

  Fly   272 ELADLNRKLSKNEEKD 287
            .||.|.:.|.:.:..|
  Rat   276 WLAQLVKNLQEGQVTD 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2053NP_001287632.1 Rcd1 28..258 CDD:281998 96/230 (42%)
Cnot9XP_038939282.1 Rcd1 25..284 CDD:397961 105/260 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5209
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53719
OrthoDB 1 1.010 - - D1129961at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12262
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.890

Return to query results.
Submit another query.