DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2003 and YOL163W

DIOPT Version :9

Sequence 1:NP_651903.2 Gene:CG2003 / 43761 FlyBaseID:FBgn0039886 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_014479.1 Gene:YOL163W / 854001 SGDID:S000005523 Length:169 Species:Saccharomyces cerevisiae


Alignment Length:72 Identity:18/72 - (25%)
Similarity:31/72 - (43%) Gaps:21/72 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 SSYYWGCAL-AQFPAGYLC------KRFGSKAVL------FWGTLG-SSLLSALTTYGVY----- 116
            ||:|...|| ..|..|::.      ..|.|.:.|      ||.||. :.:::::..:||:     
Yeast    18 SSFYTCRALMGLFEGGFVADLVLWMSYFYSSSELSIRLSFFWVTLSLTQIITSIVAFGVFHMRGI 82

  Fly   117 --AGGWK 121
              ..||:
Yeast    83 GGMAGWQ 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2003NP_651903.2 2A0114euk 23..456 CDD:129972 18/72 (25%)
MFS 58..441 CDD:119392 18/72 (25%)
YOL163WNP_014479.1 MFS 1..>151 CDD:421695 18/72 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344223
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.