powered by:
Protein Alignment CG2003 and YOL163W
DIOPT Version :9
Sequence 1: | NP_651903.2 |
Gene: | CG2003 / 43761 |
FlyBaseID: | FBgn0039886 |
Length: | 492 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_014479.1 |
Gene: | YOL163W / 854001 |
SGDID: | S000005523 |
Length: | 169 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 72 |
Identity: | 18/72 - (25%) |
Similarity: | 31/72 - (43%) |
Gaps: | 21/72 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 71 SSYYWGCAL-AQFPAGYLC------KRFGSKAVL------FWGTLG-SSLLSALTTYGVY----- 116
||:|...|| ..|..|::. ..|.|.:.| ||.||. :.:::::..:||:
Yeast 18 SSFYTCRALMGLFEGGFVADLVLWMSYFYSSSELSIRLSFFWVTLSLTQIITSIVAFGVFHMRGI 82
Fly 117 --AGGWK 121
..||:
Yeast 83 GGMAGWQ 89
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C157344223 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.