DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2003 and slc17a7

DIOPT Version :9

Sequence 1:NP_651903.2 Gene:CG2003 / 43761 FlyBaseID:FBgn0039886 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_001072608.1 Gene:slc17a7 / 780064 XenbaseID:XB-GENE-5742677 Length:576 Species:Xenopus tropicalis


Alignment Length:457 Identity:139/457 - (30%)
Similarity:223/457 - (48%) Gaps:18/457 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VPRLGLRHLQAGLLFYGLAANTVLQLNVSVAVVAMTNETT--SNNS---DPPHYNWSEEKKSYIL 70
            :||..:..:.:||   |...:..::.|:.||:|:|.|..|  ..|.   :...:.|..|....|.
 Frog    59 LPRRYIIAIMSGL---GFCISFGIRCNLGVAIVSMVNNNTVYKGNKIVIEQAQFTWDPETVGMIH 120

  Fly    71 SSYYWGCALAQFPAGYLCKRFGSKAVLFWGTLGSSLLSALTTYGVYAGGWKAYCAIRLLQGLCQ- 134
            .|::||..:.|.|.||:|::|.:..|..:..:.:|.|:.|.............| :|:||||.: 
 Frog   121 GSFFWGYIVTQIPGGYICQKFAANRVFGFAIVATSTLNMLIPSAARVHFACVIC-VRILQGLVEG 184

  Fly   135 VTWPCIHQHLANWCPTAERTRLGAFAYTGFDCGNVLAMYGAGMIASSSLGWPGISYSAAGLGLIW 199
            ||:|..|...:.|.|..||:||...|:.|...|.|:||..||::...| ||..:.|.....|::|
 Frog   185 VTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYS-GWSSVFYVYGSFGIMW 248

  Fly   200 CGLWLLLGANKASDARFIGEAEKAYIVGDIQRSE--RKGPKKMEIPWKGIFTSVPVYALLCARCA 262
            ...|:|:.....:....|.|.||.||...|..|.  .....|.:.||:..|||:||||::.|...
 Frog   249 YMFWILVSYESPAIHPTISEEEKKYIEESIGESTGLMNPMAKFKAPWRKFFTSMPVYAIIVANFC 313

  Fly   263 DSWGLTTMQTELPTYLSGVLKLDMKSNAVFSALPFLLMWVMCYVYLIIADVLLRKKWMSLTTLRK 327
            .||....:....|.|...|...::....:.||||.|:|.::..:...|||.|..|:.||.|.:||
 Frog   314 RSWTFYLLLISQPAYFEEVFGFEISKVGLLSALPHLVMTIIVPIGGQIADFLRTKRIMSTTNVRK 378

  Fly   328 TYTSIALWAPASIMLSLVIVG-EGQKTLVLVLVTLSVGVSSAATIGSELNTIDLSPNHAGILAGL 391
            ..........|:::|   :|| ...:.:.:..:.|:||.|..|..|..:|.:|::|.:|.||.|:
 Frog   379 MMNCGGFGMEATLLL---VVGYSHSRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGI 440

  Fly   392 MSSFTNLMALLTPLVVGVLVTDPSQRSQWQIVFSLAAGVLFTGNVIFLIWGTAVTQPWNESKESR 456
            .:....|..::.||:||.: |....|.:||.||.:|:.|.:.|.:.:.|:.:...|||.|.:|:.
 Frog   441 SNGVGTLSGMVCPLIVGAM-TKHKTREEWQYVFLIASLVHYGGVLFYGIFASGEKQPWAEPEETS 504

  Fly   457 RE 458
            .|
 Frog   505 DE 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2003NP_651903.2 2A0114euk 23..456 CDD:129972 135/441 (31%)
MFS 58..441 CDD:119392 119/386 (31%)
slc17a7NP_001072608.1 2A0114euk 62..503 CDD:129972 135/449 (30%)
MFS 67..490 CDD:119392 131/431 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 517..547
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.