DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2003 and Slc17a9

DIOPT Version :9

Sequence 1:NP_651903.2 Gene:CG2003 / 43761 FlyBaseID:FBgn0039886 Length:492 Species:Drosophila melanogaster
Sequence 2:XP_038961483.1 Gene:Slc17a9 / 362287 RGDID:1311940 Length:448 Species:Rattus norvegicus


Alignment Length:325 Identity:79/325 - (24%)
Similarity:138/325 - (42%) Gaps:53/325 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LQAGLLFYGLAANTVLQLNVSVAVVAMTNETTSNNSDPPHYNWSEEKKSYILSSYYWGCALAQFP 83
            |..|:|..|.......::.:.|..|||:.:          :.|::::...:|||::||..|.|..
  Rat    36 LWTGMLLLGTCLLYCTRVTMPVCTVAMSQD----------FGWNKKEAGIVLSSFFWGYCLTQVV 90

  Fly    84 AGYLCKRFGSKAVLF-----WG--TLGSSLLSALTTYGVYAGGWKAYCAI-RLLQGLCQ-VTWPC 139
            .|:|..|.|.:.|:.     ||  |:.:.||:.|      ..|..|:... |:|.||.| |.:|.
  Rat    91 GGHLGDRIGGEKVILLSASAWGFITVTTPLLAHL------GSGHLAFVTFSRILTGLLQGVYFPA 149

  Fly   140 IHQHLANWCPTAERTRLGAFAYTGFDCGN---VLAMYGAGMIASSSLGWPGISYSAAGLGLIWCG 201
            :...|:.....:||    :|.|:....|:   .|...|.|.:.....||..:.|.:.||.|:|..
  Rat   150 LTSLLSQRVQESER----SFTYSTVGAGSQVGTLVTGGIGSVLLDRCGWQSVFYFSGGLTLLWVY 210

  Fly   202 L---WLLLGANKASDARFIGEAEKAYIVGDI-QRSERKGPKKMEIPWKGIFTSVPVYALLCARCA 262
            .   :||            .|.:....:|.: |......|.|  :||:.:|....|:|::|::.:
  Rat   211 YVYKYLL------------DEKDLVLALGVLAQGLPVTRPSK--VPWRQLFRKASVWAVICSQLS 261

  Fly   263 DSWGLTTMQTELPTYLSGVLKLDMKSNAVFSALPFLLMWVMCYVYLIIADVLLRKKWMSLTTLRK 327
            .:.....:.:.|||:....  .......||:.:|:||..........|:|.|:.:.: .:.|:||
  Rat   262 SACSFFILLSWLPTFFKET--FPHSKGWVFNVVPWLLAIPASLFSGFISDRLISQGY-RVITVRK 323

  Fly   328  327
              Rat   324  323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2003NP_651903.2 2A0114euk 23..456 CDD:129972 77/321 (24%)
MFS 58..441 CDD:119392 71/286 (25%)
Slc17a9XP_038961483.1 MFS 38..>326 CDD:421695 78/323 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.