DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2003 and MFS18

DIOPT Version :9

Sequence 1:NP_651903.2 Gene:CG2003 / 43761 FlyBaseID:FBgn0039886 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_608835.1 Gene:MFS18 / 33650 FlyBaseID:FBgn0025684 Length:439 Species:Drosophila melanogaster


Alignment Length:410 Identity:106/410 - (25%)
Similarity:176/410 - (42%) Gaps:60/410 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 WSEEKKSYILSSYYWGCALAQFPAGYLCKRFGSKAVLFWGTLGSSLLSALTTYGVY-AGGWKAYC 124
            ||:.....:|||::||..|.|...||...|||.:.|:.:..:|.||::.|....:: ||..|:|.
  Fly    60 WSKTDSGTVLSSFFWGYTLTQVVGGYFSDRFGGQRVILFAAIGWSLITFLMPTIIWTAGSIKSYA 124

  Fly   125 -----AIRLLQGLCQ-VTWP-CIHQHLANWCPTAERTRLGAFAYTGFDCGNVLAMYGAGMIASSS 182
                 |||:|.|..| |.:| .|.....|.||. ||:........|...|.:|    .|::.|..
  Fly   125 IPFIVAIRILNGALQGVHFPSMISLTSQNLCPN-ERSSFFGLLTAGSALGTLL----TGIMGSFL 184

  Fly   183 LGWPGISYSAAGLGLIWCGL-WLLLGANKASDARFIGEAEKAYIVGDIQRSER----KGPKKME- 241
            |.:.|.||....:||:  |: |.|:       .|:...|.:...:.:|....|    |.|.:.. 
  Fly   185 LDYFGWSYVFRVIGLM--GIAWALV-------LRYYAMAGERNRIINIATPSRLCANKSPAETSA 240

  Fly   242 IPWKGIFTSVPVYALLCARCADSWGLTTMQTELPTYLSGVLKLDMKSNAVFSALPFLLMWVM--- 303
            :||...|..:..:|.:.....:......:.:.||||.             ....|....||:   
  Fly   241 VPWLRYFRRLSFWACVLTHACEMNCFFVLLSWLPTYF-------------HDGFPHAKGWVVNMI 292

  Fly   304 -------CYVYL-IIADVLLRKKWMSLTTLRKTYTSIALWAPASIMLSLVIVGE-GQKTLVLVLV 359
                   |.::. .:...||.::|.: ||:||...|...   |:..|:|.::.. ......|:.:
  Fly   293 PWLALPPCTLFAKYLTTRLLAREWHT-TTVRKVIQSCCF---AAQNLALFVMSRTSDFHTALICM 353

  Fly   360 TLSVGVSSAATIGSELNTIDLSPNHAGILAGLMSSFTNLMALLTPLVVGVLVTDPSQRSQWQIVF 424
            |:.:|.:........:|..||:|.|:|.:.|||::...:...|...:.|.::   .....|.:||
  Fly   354 TIIIGGTGFHNNAVTVNPQDLAPLHSGSVFGLMNTVGAIPGFLGVYLAGHIL---ELTQSWPMVF 415

  Fly   425 SLAAGVLFTGNVIFLIWGTA 444
            |.|||:...|.:||:::|:|
  Fly   416 SAAAGINLVGWIIFIVFGSA 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2003NP_651903.2 2A0114euk 23..456 CDD:129972 106/410 (26%)
MFS 58..441 CDD:119392 104/405 (26%)
MFS18NP_608835.1 MFS 30..432 CDD:119392 104/405 (26%)
MFS_1 32..397 CDD:284993 92/367 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451998
Domainoid 1 1.000 116 1.000 Domainoid score I288
eggNOG 1 0.900 - - E1_KOG2532
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I245
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11662
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.