DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2003 and CG14439

DIOPT Version :9

Sequence 1:NP_651903.2 Gene:CG2003 / 43761 FlyBaseID:FBgn0039886 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_001188550.1 Gene:CG14439 / 31614 FlyBaseID:FBgn0029898 Length:535 Species:Drosophila melanogaster


Alignment Length:264 Identity:48/264 - (18%)
Similarity:89/264 - (33%) Gaps:98/264 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 GLTTMQT---------------------ELPTYLSGVLK------LDMKSNA------------- 290
            |:|:.||                     ||||..|.|:.      ||.....             
  Fly    35 GVTSKQTAIELDYGDHACQQNTSMFNRHELPTQCSAVMNETSCYALDFNGTGYCEWNYNGLGIDY 99

  Fly   291 -VFSALPFLLMWVMCYVYL-IIADVLLRKKWMSLTTL-----------RKTYTSIALWA------ 336
             :.:...|:|::.:..|:: ..||...|...:::.|:           .|.|..:.:..      
  Fly   100 QILAGPTFILIFTIAGVFMGFAADKYNRVNMLTVCTVIFGIAMILQGTVKEYWQLVILRMIMAAG 164

  Fly   337 -----PASIMLSLVIVGEGQKTLVLVLVTLSV--GVSSAATIG---SELNTIDLSPNHAGILAGL 391
                 |.:..:...|..|.::.||:.:....:  |...|..:|   ::||..:|......:.||:
  Fly   165 ESGCNPLATGIMSDIFPEDKRALVMAIFNWGIYGGYGIAFPVGRYITKLNFWNLGWRVCYLGAGV 229

  Fly   392 MSSFTNLMALLTPLVVGVLVTDPSQR---------------SQWQIV-------FSLAAGVLFTG 434
            :   |.:||.||    |..:.:|.::               |.||::       ..:||.:...|
  Fly   230 L---TVIMAALT----GTTLREPERKAIGEGDRQTSSGKPVSLWQVIKNPAMIMLMIAASIRHCG 287

  Fly   435 NVIF 438
            .:.|
  Fly   288 GMTF 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2003NP_651903.2 2A0114euk 23..456 CDD:129972 48/264 (18%)
MFS 58..441 CDD:119392 48/264 (18%)
CG14439NP_001188550.1 MFS_1 94..416 CDD:284993 36/205 (18%)
MFS 107..452 CDD:119392 36/192 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D619250at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.