DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2003 and SLC37A4

DIOPT Version :9

Sequence 1:NP_651903.2 Gene:CG2003 / 43761 FlyBaseID:FBgn0039886 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_001157750.1 Gene:SLC37A4 / 2542 HGNCID:4061 Length:451 Species:Homo sapiens


Alignment Length:442 Identity:91/442 - (20%)
Similarity:153/442 - (34%) Gaps:96/442 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 YILSSYYWGCALAQFPAGYLCKRFGSKAVLFWGTLGSSLLSALTTYGVYAGGWKAYCAIRLLQGL 132
            :|.||.....|:::|.:|.|..:..::.:...|.|   |:..:..:..::.....:.|:..|.||
Human    51 FITSSQSAAYAISKFVSGVLSDQMSARWLFSSGLL---LVGLVNIFFAWSSTVPVFAALWFLNGL 112

  Fly   133 CQ-VTWPCIHQHLANWCPTAERTRLGAFAYTGFD----CGNVLAMYGAGMIASSSLGWPGISYSA 192
            .| :.||...:.|..|...::.....|...|..:    .|.:||     .|.:.|..|......:
Human   113 AQGLGWPPCGKVLRKWFEPSQFGTWWAILSTSMNLAGGLGPILA-----TILAQSYSWRSTLALS 172

  Fly   193 AGLGLIWCGLWLLLGANKASDARFIGEAEKAYIVG----DIQRSE-RKGPKKMEIPWKGIFTSVP 252
            ..|.::...|.|||..|:.:|            ||    |...|| :||..|.|...:.:..|..
Human   173 GALCVVVSFLCLLLIHNEPAD------------VGLRNLDPMPSEGKKGSLKEESTLQELLLSPY 225

  Fly   253 VYALLCA--------RCADSWGLTTM-----QTEL--PTYLS-------------GVLK------ 283
            ::.|...        .|...||...:     |:.|  .:|:|             |.|.      
Human   226 LWVLSTGYLVVFGVKTCCTDWGQFFLIQEKGQSALVGSSYMSALEVGGLVGSIAAGYLSDRAMAK 290

  Fly   284 --LDMKSNAVFSALPFLLMWVMCYVYLIIADVLLRKKWMSLTTLRKTYTS-----IALWAPASIM 341
              |....|.....|.|::..:...:||                .|.|.||     :|.|..|...
Human   291 AGLSNYGNPRHGLLLFMMAGMTVSMYL----------------FRVTVTSDSPKDVAFWTLALHP 339

  Fly   342 LSLVIVGEGQKTLVLVLVTLSVGVSS---AATIGSELNTIDLSPNHAGILAGLMSSFTNLMALLT 403
            |: .:.|..:..|.::::....|.||   .|..|...|. ...||    |.|...:...|||.:.
Human   340 LA-ELTGFTEHELWILVLGAVFGFSSYGPIALFGVIANE-SAPPN----LCGTSHAIVGLMANVG 398

  Fly   404 PLVVGVLVTDPSQRSQWQIVFSLAAGVLFTGNVIFLIWGTAVTQPWNESKES 455
            ..:.|:..:..::...|...|.:|..:.......|.:.....|:....||::
Human   399 GFLAGLPFSTIAKHYSWSTAFWVAEVICAASTAAFFLLRNIRTKMGRVSKKA 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2003NP_651903.2 2A0114euk 23..456 CDD:129972 91/442 (21%)
MFS 58..441 CDD:119392 88/426 (21%)
SLC37A4NP_001157750.1 MFS 14..437 CDD:119392 88/427 (21%)
2A0104 18..419 CDD:273319 85/409 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148682
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.