powered by:
Protein Alignment CG2003 and T05H10.3
DIOPT Version :9
Sequence 1: | NP_651903.2 |
Gene: | CG2003 / 43761 |
FlyBaseID: | FBgn0039886 |
Length: | 492 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_495688.1 |
Gene: | T05H10.3 / 174292 |
WormBaseID: | WBGene00011508 |
Length: | 158 |
Species: | Caenorhabditis elegans |
Alignment Length: | 33 |
Identity: | 8/33 - (24%) |
Similarity: | 12/33 - (36%) |
Gaps: | 2/33 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 45 MTNETTSNNSDPPHYNWSEEKKSYILSSYYWGC 77
:|.:....|.: |..|...|......:|..||
Worm 101 ITYQVEKRNDE--HVLWRSGKCLNSTVNYRIGC 131
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG2003 | NP_651903.2 |
2A0114euk |
23..456 |
CDD:129972 |
8/33 (24%) |
MFS |
58..441 |
CDD:119392 |
6/20 (30%) |
T05H10.3 | NP_495688.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG2532 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.