DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2003 and T05H10.3

DIOPT Version :9

Sequence 1:NP_651903.2 Gene:CG2003 / 43761 FlyBaseID:FBgn0039886 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_495688.1 Gene:T05H10.3 / 174292 WormBaseID:WBGene00011508 Length:158 Species:Caenorhabditis elegans


Alignment Length:33 Identity:8/33 - (24%)
Similarity:12/33 - (36%) Gaps:2/33 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 MTNETTSNNSDPPHYNWSEEKKSYILSSYYWGC 77
            :|.:....|.:  |..|...|......:|..||
 Worm   101 ITYQVEKRNDE--HVLWRSGKCLNSTVNYRIGC 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2003NP_651903.2 2A0114euk 23..456 CDD:129972 8/33 (24%)
MFS 58..441 CDD:119392 6/20 (30%)
T05H10.3NP_495688.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.