DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rift and slc52a2

DIOPT Version :10

Sequence 1:NP_651901.3 Gene:Rift / 43756 FlyBaseID:FBgn0039882 Length:487 Species:Drosophila melanogaster
Sequence 2:XP_073786673.1 Gene:slc52a2 / 323832 ZFINID:ZDB-GENE-030131-2552 Length:885 Species:Danio rerio


Alignment Length:122 Identity:24/122 - (19%)
Similarity:39/122 - (31%) Gaps:48/122 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 NQTASVAGTD----HSLALF-----LLTCFTALNACTSSVL----FMPYMGRF-------KEQYM 209
            |:.|.|...|    |..|:.     |.:....:.|.|..::    |:.|:.:|       .||.|
Zfish   357 NEAAKVVSLDLLQNHFNAMLKNDDDLRSLDEKVKASTHPIVPPLDFLRYISQFLFELIDVTEQQM 421

  Fly   210 VTYFIGEGLSGLLPSVTALIQGIGESGDCVLVNVTESGEEVYALRKTPPRFDTRVFF 266
            :::                      ..|.|.....:.|.:.:      |||.|.|.|
Zfish   422 ISF----------------------EKDIVFTTAEKLGRDKH------PRFQTFVNF 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RiftNP_651901.3 DUF1011 320..418 CDD:461856
slc52a2XP_073786673.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.