DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42233 and AT1G78070

DIOPT Version :9

Sequence 1:NP_651899.2 Gene:CG42233 / 43754 FlyBaseID:FBgn0250755 Length:773 Species:Drosophila melanogaster
Sequence 2:NP_565168.4 Gene:AT1G78070 / 844142 AraportID:AT1G78070 Length:449 Species:Arabidopsis thaliana


Alignment Length:170 Identity:45/170 - (26%)
Similarity:67/170 - (39%) Gaps:34/170 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 DKRVLLWNIDRELVSKLGKPRSMNEKHASNIFCLGF-----DTQNSY-----------IFSGGND 165
            |..::......||:.|     .:||...:  ||...     |..||.           :.:..||
plant   202 DDLIVAGGFQGELICK-----KINEPEVA--FCTKLTSADNDITNSVDIYNAPSGSLRVMTANND 259

  Fly   166 DLVIQHDLETGKILNHFSHDGPVYGLSVDRIS----GHLLSVATEHGEILVYDLRAGKSEPLAIA 226
            ..|...|.....:||.|:     :..||:.||    |.|::|..:..|.|:.|..:||.......
plant   260 CTVRLFDATNFALLNRFA-----FHWSVNNISTSPDGKLVAVLGDSPECLLADTGSGKVIHGLEG 319

  Fly   227 KFKTPFNAVEFHPLNGNFLATANAKRGAMLWDLRHHQQAL 266
            .....|::. :|| ||..|||.|......|||:|:..|:|
plant   320 HLDYSFSSA-WHP-NGQILATGNQDTTCRLWDVRNLSQSL 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42233NP_651899.2 WD40 <45..404 CDD:225201 45/170 (26%)
WD40 repeat 56..91 CDD:293791
WD40 90..402 CDD:295369 45/170 (26%)
WD40 repeat 100..142 CDD:293791 5/24 (21%)
WD40 repeat 147..183 CDD:293791 11/51 (22%)
WD40 repeat 191..225 CDD:293791 12/37 (32%)
WD40 repeat 232..270 CDD:293791 15/35 (43%)
WD40 repeat 278..371 CDD:293791
WD40 repeat 377..401 CDD:293791
AT1G78070NP_565168.4 WD40 repeat 237..277 CDD:293791 8/39 (21%)
WD40 252..>429 CDD:421866 34/113 (30%)
WD40 repeat 283..318 CDD:293791 10/34 (29%)
WD40 repeat 325..361 CDD:293791 15/35 (43%)
WD40 repeat 367..404 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.