DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42233 and AT3G13340

DIOPT Version :9

Sequence 1:NP_651899.2 Gene:CG42233 / 43754 FlyBaseID:FBgn0250755 Length:773 Species:Drosophila melanogaster
Sequence 2:NP_001189878.1 Gene:AT3G13340 / 820534 AraportID:AT3G13340 Length:447 Species:Arabidopsis thaliana


Alignment Length:283 Identity:69/283 - (24%)
Similarity:114/283 - (40%) Gaps:39/283 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RTEQNLNQSPSPFKGSISTSVQRKPGDGARKMSLWRNLRSLET-------RNLDVALSQRENILV 68
            |.||..|....|..|..|..|.:....|......|||.||:::       |||..|.|:.:..|:
plant    85 RLEQYKNYENVPNSGESSEKVCKVTQKGGLFYDFWRNSRSIKSTILHFQLRNLVWATSKHDVYLM 149

  Fly    69 AGHLPSAIFRERLSAAQNLYQRNLTGHYGCVNALEFSSGG-----------------QFLASGGD 116
            :..|.:. :....|....:.  |:.||   |...|...|.                 .||.:||.
plant   150 SNFLVTH-YSSLTSGKHEVL--NVRGH---VAPSEKHPGSLLEGFTQTQVSTLAVKDDFLVAGGF 208

  Fly   117 DKRVLLWNIDRELVSKLGKPRSMNEKHASNIFCLGFDTQNSYIFSGGNDDL-VIQHDLETGKILN 180
            ...::..::||..||...: .:.::...:|...:......:..|:..|:|. |...|:|..:::.
plant   209 QGELICKHLDRPGVSFCSR-MTYDDNAITNAIEIYNKPSGALHFTASNNDCGVRDFDMERYQLVK 272

  Fly   181 HFSHDGPV--YGLSVDRISGHLLSVATEHGEILVYDLRAGKSEPLAIAKFKTPFNAVEFHPLNGN 243
            ||....||  ..||.|   |.||::..::.|.|:.|...||:...........| |..:|| :|.
plant   273 HFRFPWPVNHASLSPD---GKLLAIVGDNPEGLIVDPNTGKTLETLSGHLDFSF-ASAWHP-DGV 332

  Fly   244 FLATANAKRGAMLWDLRHHQQAL 266
            ..:|.|..:...:||:|:..|::
plant   333 TFSTGNQDKTCRVWDIRNLSQSV 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42233NP_651899.2 WD40 <45..404 CDD:225201 60/249 (24%)
WD40 repeat 56..91 CDD:293791 6/34 (18%)
WD40 90..402 CDD:295369 47/197 (24%)
WD40 repeat 100..142 CDD:293791 10/58 (17%)
WD40 repeat 147..183 CDD:293791 7/36 (19%)
WD40 repeat 191..225 CDD:293791 11/33 (33%)
WD40 repeat 232..270 CDD:293791 11/35 (31%)
WD40 repeat 278..371 CDD:293791
WD40 repeat 377..401 CDD:293791
AT3G13340NP_001189878.1 WD40 repeat 194..231 CDD:293791 8/37 (22%)
WD40 repeat 235..275 CDD:293791 8/39 (21%)
WD40 <251..427 CDD:392136 32/110 (29%)
WD40 repeat 280..316 CDD:293791 12/38 (32%)
WD40 repeat 323..358 CDD:293791 11/35 (31%)
WD40 repeat 365..402 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.