DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42233 and adp

DIOPT Version :10

Sequence 1:NP_651899.2 Gene:CG42233 / 43754 FlyBaseID:FBgn0250755 Length:773 Species:Drosophila melanogaster
Sequence 2:NP_611296.2 Gene:adp / 37073 FlyBaseID:FBgn0000057 Length:628 Species:Drosophila melanogaster


Alignment Length:585 Identity:138/585 - (23%)
Similarity:197/585 - (33%) Gaps:272/585 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 GHLPSAIFRERLSAAQNLYQR-----NLTGHYGCVNALEFSSGGQFLASGGDDKRVLLWNIDREL 129
            ||....:.|.||.|:.....|     .|.||.||||.||:::.|.:||||.||.||::|:..|:.
  Fly    36 GHELDEMLRRRLLASPAYVDRLEQEAVLVGHEGCVNCLEWTTDGMWLASGSDDYRVMIWDPFRKK 100

  Fly   130 VSKLGKPRSMNEKHASNIFCLGF--DTQNS-----------YIF--------------------- 160
            :..:     :..||..|:|.:.|  .|.||           |::                     
  Fly   101 LVHV-----IRTKHLGNVFSVKFLPKTNNSIVATCAADKFIYVYDINDPNETLFSCICHFSRAKR 160

  Fly   161 ------------SGGNDDLVIQHDL--------ETG---KILNHFSHD----------------- 185
                        |.|.|..::|.|:        |.|   ::||  .||                 
  Fly   161 LATAQDSPHVFWSAGEDGCILQLDIREPHRCRPEEGIGVRLLN--LHDQLENTEAKCLAINPRRT 223

  Fly   186 -----------GPVY-----------GLS-----------VDRISGHL------LSVATEHG--- 208
                       ..||           |||           |..||.::      ::..|.:|   
  Fly   224 EYLAVGTNDPFARVYDRRKLPSTNGNGLSACVAYYAPGQIVKNISRNIVHEPRGITYLTFNGNGT 288

  Fly   209 EILV--------------------YDLRAGKS------EPLAIAKFKTPFNA------VEFHPLN 241
            |:||                    |||.|..|      ||:     |.|..:      :|.:...
  Fly   289 ELLVNIGCEHVYRFDLNHAEPPVFYDLPAFTSTLVHEEEPV-----KMPHRSRSLPTEIEVYKKE 348

  Fly   242 GN-FL-----------------------------ATANAKRG------AMLWD-----------L 259
            || ||                             |||..:||      |.|.|           :
  Fly   349 GNDFLENGKLVDAIDAYSAALAKYPQGEVLYLNRATALMRRGWFGDIYAALRDCHEALRLDPSYV 413

  Fly   260 RHH---QQALCQYNYIPESPSCMSV---RF----NCNGTLLLTL----HRRLPPILYSPGAPE-- 308
            :.|   .:||.:.:...::..|:..   ||    |.:|.|:|..    :||...   ||.|||  
  Fly   414 KAHFRLARALLELHRPQDADQCLQALIQRFPDFANNHGVLMLNKDIKENRRQSK---SPEAPELQ 475

  Fly   309 PV---------------------ATFYHDEYFNSCT----MKSCTFAGPQDELVVSGSDNFNMFI 348
            ||                     |..|...|...|.    :|...:.|.|.|.:.:|||:.||:|
  Fly   476 PVEVDDGFRYLRLKNAEYDLRSTARDYMQRYVGHCNVTTDIKEANYLGSQGEFIAAGSDDGNMYI 540

  Fly   349 WRLEGVDLDEKNQWMETTPVILAGHR---SIVNQVRYNRERCLLASSGVEKIIKLWSPFAQQGWE 410
            |  ||           .|..|.|.:|   :|||.|:.:...|:||:||::..||:|||.|....|
  Fly   541 W--EG-----------DTGKIRAVYRADSAIVNCVQPHPSICMLATSGIDHNIKIWSPCAASAEE 592

  Fly   411  410
              Fly   593  592

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42233NP_651899.2 WD40 2..403 CDD:441893 134/576 (23%)
WD40 repeat 56..91 CDD:293791 7/25 (28%)
WD40 repeat 100..142 CDD:293791 14/41 (34%)
WD40 repeat 147..183 CDD:293791 15/92 (16%)
WD40 repeat 191..225 CDD:293791 17/79 (22%)
WD40 repeat 232..270 CDD:293791 16/93 (17%)
WD40 repeat 278..371 CDD:293791 35/130 (27%)
WD40 repeat 377..401 CDD:293791 10/23 (43%)
adpNP_611296.2 WD40 54..>242 CDD:475233 43/194 (22%)
WD40 repeat 72..108 CDD:293791 13/40 (33%)
WD40 repeat 114..154 CDD:293791 6/39 (15%)
WD40 repeat 158..203 CDD:293791 7/44 (16%)
WD40 repeat 214..268 CDD:293791 6/53 (11%)
Spy 338..>461 CDD:443119 23/122 (19%)
TPR repeat 342..370 CDD:276809 5/27 (19%)
TPR repeat 375..408 CDD:276809 8/32 (25%)
TPR repeat 413..441 CDD:276809 4/27 (15%)
WD40 repeat 513..553 CDD:293791 16/52 (31%)
WD40 <526..584 CDD:475233 25/70 (36%)

Return to query results.
Submit another query.