DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42233 and WDTC1

DIOPT Version :9

Sequence 1:NP_651899.2 Gene:CG42233 / 43754 FlyBaseID:FBgn0250755 Length:773 Species:Drosophila melanogaster
Sequence 2:NP_001263181.1 Gene:WDTC1 / 23038 HGNCID:29175 Length:677 Species:Homo sapiens


Alignment Length:643 Identity:124/643 - (19%)
Similarity:182/643 - (28%) Gaps:316/643 - (49%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 KMSLWRNL--RSLETRNLDVALSQRENILVAGHLPSAIFRERLSAAQNLYQRNLTGHYGCVNALE 103
            |:::.|:|  |.::.|.   |||.....    |:.....| ||.     .:..|.||.||||.||
Human     3 KVNITRDLIRRQIKERG---ALSFERRY----HVTDPFIR-RLG-----LEAELQGHSGCVNCLE 54

  Fly   104 FSSGGQFLASGGDDKRVLLWNIDRELVSKLGKPRSMNEKHASNIFCLGF--DTQNSYIFSGGNDD 166
            ::..|..||||.||:..::|:   .|..|  |..||:..|.:|||.:.|  ...:..:.:|..|.
Human    55 WNEKGDLLASGSDDQHTIVWD---PLHHK--KLLSMHTGHTANIFSVKFLPHAGDRILITGAADS 114

  Fly   167 LVIQHDLETGKILNHF-SHDGPVYGLSVDRISGHLLSVATEHGEILVYDLRAGKSE--------- 221
            .|..|||...:.::.| .|...|..::...:..:....|.|.|.|..||||.....         
Human   115 KVHVHDLTVKETIHMFGDHTNRVKRIATAPMWPNTFWSAAEDGLIRQYDLRENSKHSEVLIDLTE 179

  Fly   222 ---PLAIAKFKTPFNAVEFHPLNGNFLATANAKRGAMLWDLR---HHQQALCQ------------ 268
               .|..||..|      .:|.:.|.||...:.....|:|:|   :|::::.|            
Human   180 YCGQLVEAKCLT------VNPQDNNCLAVGASGPFVRLYDIRMIHNHRKSMKQSPSAGVHTFCDR 238

  Fly   269 -----------------------YN---------YIPESPSCMSVRFNCNG-------------- 287
                                   ||         |:..||:...:..|..|              
Human   239 QKPLPDGAAQYYVAGHLPVKLPDYNNRLRVLVATYVTFSPNGTELLVNMGGEQVYLFDLTYKQRP 303

  Fly   288 -TLLLT----------------------------LHR----------------RLPPI------- 300
             |.||.                            ||.                .|||.       
Human   304 YTFLLPRKCHSSGEVQNGKMSTNGVSNGVSNGLHLHSNGFRLPESRGHVSPQVELPPYLERVKQQ 368

  Fly   301 ---------------LYS----------------------------------------------- 303
                           |||                                               
Human   369 ANEAFACQQWTQAIQLYSKAVQRAPHNAMLYGNRAAAYMKRKWDGDHYDALRDCLKAISLNPCHL 433

  Fly   304 -------------------------------------------------------------PGAP 307
                                                                         ||..
Human   434 KAHFRLARCLFELKYVAEALECLDDFKGKFPEQAHSSACDALGRDITAALFSKNDGEEKKGPGGG 498

  Fly   308 EPV---------------------ATFYHDEYFNSCT----MKSCTFAGPQDELVVSGSDNFNMF 347
            .||                     :..|...|...|.    :|...|.|...:.:|||||:.:.|
Human   499 APVRLRSTSRKDSISEDEMVLRERSYDYQFRYCGHCNTTTDIKEANFFGSNAQYIVSGSDDGSFF 563

  Fly   348 IWRLEGVDLDEKNQWMETTPV--ILAGHRSIVNQVRYNRERCLLASSGVEKIIKLWSP 403
            ||        ||    |||.:  :|.|..||||.::.:...|.||:||::.:::||:|
Human   564 IW--------EK----ETTNLVRVLQGDESIVNCLQPHPSYCFLATSGIDPVVRLWNP 609

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42233NP_651899.2 WD40 <45..404 CDD:225201 123/639 (19%)
WD40 repeat 56..91 CDD:293791 7/34 (21%)
WD40 90..402 CDD:295369 110/589 (19%)
WD40 repeat 100..142 CDD:293791 16/41 (39%)
WD40 repeat 147..183 CDD:293791 10/38 (26%)
WD40 repeat 191..225 CDD:293791 9/45 (20%)
WD40 repeat 232..270 CDD:293791 9/75 (12%)
WD40 repeat 278..371 CDD:293791 36/308 (12%)
WD40 repeat 377..401 CDD:293791 7/23 (30%)
WDTC1NP_001263181.1 WD40 <34..163 CDD:421866 43/139 (31%)
WD 1 45..84 19/43 (44%)
WD40 repeat 51..88 CDD:293791 16/41 (39%)
WD 2 88..129 11/40 (28%)
WD40 repeat 93..131 CDD:293791 9/37 (24%)
WD 3 132..172 10/39 (26%)
WD40 repeat 138..178 CDD:293791 8/39 (21%)
WD 4 182..222 12/45 (27%)
WD40 repeat 232..271 CDD:293791 2/38 (5%)
WD 5 265..305 5/39 (13%)
TPR 1 362..395 3/32 (9%)
TPR repeat 366..390 CDD:276809 3/23 (13%)
PLN03088 368..>438 CDD:215568 3/69 (4%)
TPR repeat 395..428 CDD:276809 0/32 (0%)
TPR 2 397..432 0/34 (0%)
TPR repeat 433..457 CDD:276809 0/23 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 487..509 4/21 (19%)
WD 6 535..575 16/51 (31%)
WD40 repeat 537..577 CDD:293791 16/51 (31%)
WD40 <546..>626 CDD:421866 28/76 (37%)
WD 7 578..617 13/32 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 655..677
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270484at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.