DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir100a and Ir76a

DIOPT Version :10

Sequence 1:NP_651898.2 Gene:Ir100a / 43753 FlyBaseID:FBgn0039879 Length:603 Species:Drosophila melanogaster
Sequence 2:NP_001097647.3 Gene:Ir76a / 40157 FlyBaseID:FBgn0260874 Length:646 Species:Drosophila melanogaster


Alignment Length:34 Identity:8/34 - (23%)
Similarity:14/34 - (41%) Gaps:7/34 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 LHGEYS-LHQPDGKLRTVKYSSNKHSGFQAEVLI 130
            |.|.|| :..|..|.:.:.      .|.|..:::
  Fly   122 LAGRYSDILDPQEKFKRIM------RGIQGALIV 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir100aNP_651898.2 HisJ 189..>287 CDD:440596
Ir76aNP_001097647.3 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.