DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir100a and Ir11a

DIOPT Version :9

Sequence 1:NP_651898.2 Gene:Ir100a / 43753 FlyBaseID:FBgn0039879 Length:603 Species:Drosophila melanogaster
Sequence 2:NP_572795.2 Gene:Ir11a / 32189 FlyBaseID:FBgn0030385 Length:642 Species:Drosophila melanogaster


Alignment Length:439 Identity:84/439 - (19%)
Similarity:147/439 - (33%) Gaps:129/439 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 VTGADAKLAKTVARQLNFTADFVWPDD--EFFGGRLANGEYSGGVGRAHRGEVDIIFAGFFIKDY 265
            :.|.|..|.:.:|:.|.|......|.:  :.||    .|..||...:...|.|.|...|....|.
  Fly   273 LAGIDWDLLQLLAKALKFRIQLYMPQEPSQIFG----EGNVSGCFRQLADGTVSIAIGGLSGSDK 333

  Fly   266 LTTHIQFSAAVYMDELCLYVKKAQ---RIPQSILPLFAVHMDVWLCFLLVGLLGALVWLILR--- 324
            ..:....|...:.....:.|::.:   |:...|||.......|.:..||:.:| :..||..|   
  Fly   334 RRSLFSKSTVYHQSNFVMVVRRDRYLGRLGPLILPFRGKLWGVIIVILLLAVL-STCWLRSRLGL 397

  Fly   325 ------AVNLILGIEGVPDGSRATRISYFGAARRIFVDTWVIWVRVNVGRFPPFHSERIFVASLC 383
                  .:.:|:| ..:||                             .|.|.....|..:||..
  Fly   398 SHPIEDLLTVIVG-NPIPD-----------------------------HRLPGKGFLRYLLASWM 432

  Fly   384 LVSVIFGALLESSLATVY----IRPLYYRDVNTLRELDESGQPIYIKHPAFKDDLFYGHNSEVYR 444
            |::::.....::.|..|.    .|||         ..|.||        ..||:           
  Fly   433 LLTLVLRCAYQARLFDVLRLSRHRPL---------PKDLSG--------LIKDN----------- 469

  Fly   445 RLDAKMMLVAEGEERL--IEMVSKR-----GGFAGVTRSASLQ-------LSDIRYVMTKKVHKI 495
                 ..:||.|....  :|:..::     ..|..|.|:|..:       :|::.|..    ||.
  Fly   470 -----YTMVANGYHDFYPLELTCRQPLDFSARFERVQRAAPDERLTTIALISNLAYWN----HKH 525

  Fly   496 PECPK---------NYHIAYVLPRPSPYLEEVNRIVLRLVAGGIVGLWTGEAKERAKWSIQRFPE 551
            |...:         .||:....||.......::|.:.:|::.|::.     ..||      |:.:
  Fly   526 PNISRLTFVRQPIYMYHLVIYFPRRFFLRPAIDRKIKQLLSAGVMA-----HIER------RYMQ 579

  Fly   552 Y-----LAELDVGRWKVLTLSDVQLAFYALTIGCLLSAIVCMAEILLGR 595
            |     :|..|....:.:|.|.:..|:....:..:|:..:.:.|:|.||
  Fly   580 YENKRKVASNDPVLLRRITKSIMNGAYRIHGLVIVLATGMFILELLAGR 628

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir100aNP_651898.2 Periplasmic_Binding_Protein_Type_2 210..>255 CDD:304360 12/46 (26%)
Lig_chan <439..580 CDD:278489 29/168 (17%)
Ir11aNP_572795.2 Periplasmic_Binding_Protein_Type_2 306..>356 CDD:304360 10/49 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.