DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir100a and Ir94f

DIOPT Version :9

Sequence 1:NP_651898.2 Gene:Ir100a / 43753 FlyBaseID:FBgn0039879 Length:603 Species:Drosophila melanogaster
Sequence 2:NP_732868.2 Gene:Ir94f / 318632 FlyBaseID:FBgn0051225 Length:558 Species:Drosophila melanogaster


Alignment Length:279 Identity:49/279 - (17%)
Similarity:101/279 - (36%) Gaps:87/279 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   357 TWVIWVR-VNVGRF----PPFHSERIFVASLCLVSVIFGALLESSLATVYIRPLYYRDVNTLREL 416
            ||:|.:. .:|.||    ....|..|.:..| |:::.....|::.|:..:|.|.....::.::::
  Fly   311 TWLILLLFYSVHRFLAQKTRLRSSLIHLIKL-LINLSLICFLQAQLSAYFIGPQKVNHISNMQQV 374

  Fly   417 DESGQPI------YIKHPAFKDDLFYGHNSEVYRRLDAKMMLVAEGEERLIEMVSKRGGFAGVTR 475
            :|||..|      ::::|.           ::..|..:..:|    .:...::...|.   .:..
  Fly   375 EESGLKIRGMRGEFMEYPI-----------DMRSRYASSFLL----HDLFFDLAQYRN---SLNT 421

  Fly   476 SASLQLSDIRYVMTKKVHKIPECPKNYHIAYVLPRPSPYLEEV---------------------N 519
            |....::.:::.:.|:..:        |....|.|   |.||:                     :
  Fly   422 SYGYTVTSVKWELYKEAQR--------HFRRPLFR---YSEEICVQKLSLFSLIQQSNCIYCYRS 475

  Fly   520 RI-VLRLVAGGIVGLWTGEAKERAKWSIQRFPEYLAELDVGRWKVLTLSDV-----------QLA 572
            || :||:...|::.||...:             |...:..||:.:..||.|           |..
  Fly   476 RIFILRMHEAGLIRLWYRRS-------------YYVMVTAGRFPIGDLSTVHRAQPIRWTEWQNV 527

  Fly   573 FYALTIGCLLSAIVCMAEI 591
            .....:|.|.|.:|.:.|:
  Fly   528 VLLHGVGLLFSVVVFVIEL 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir100aNP_651898.2 Periplasmic_Binding_Protein_Type_2 210..>255 CDD:304360
Lig_chan <439..580 CDD:278489 25/173 (14%)
Ir94fNP_732868.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.