DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir100a and glr-8

DIOPT Version :9

Sequence 1:NP_651898.2 Gene:Ir100a / 43753 FlyBaseID:FBgn0039879 Length:603 Species:Drosophila melanogaster
Sequence 2:NP_001368711.1 Gene:glr-8 / 180924 WormBaseID:WBGene00001619 Length:547 Species:Caenorhabditis elegans


Alignment Length:425 Identity:94/425 - (22%)
Similarity:165/425 - (38%) Gaps:81/425 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 GADAKLAKTVARQLNFTADFV------WPDDEFFGGRLANGEYSGGVGRAHRGEVDIIFAGFFIK 263
            |...::.|.:.::||.|.:.:      |       |...||.::|..|:..|||||:: ||..|.
 Worm    94 GVVMEILKEIGKRLNLTYEILPALGSTW-------GEYLNGSWTGAFGQLVRGEVDLL-AGGAIM 150

  Fly   264 DY-------LTTHIQF--------SAAVYMDELCLYVKKAQRIPQSILPLFAVHMDVWLCFLLVG 313
            :|       ||...||        |...|.|:..|.|.:    |.|        .:||:....|.
 Worm   151 EYDRSVIADLTYPFQFEPTGIMIRSPEKYEDDTLLIVTE----PFS--------WEVWVITAAVI 203

  Fly   314 LLGALVWLILRAVNLILGIEGVPDGSRATRISYFGAARRIFVDTWV---IWVRVNVGRFPPFHSE 375
            |:..:::|::  .|:|             |..|.......|...||   |:|:..:...|...|.
 Worm   204 LISGVIFLVM--TNII-------------RKVYEEMTVTPFESIWVFFSIFVQQGLPEQPRSWSC 253

  Fly   376 RIFVASLCLVSVIFGALLESSLATVYI---RPLYYRDVNTLRELDESGQ-PIYIKHPAF-KDDLF 435
            |:.||...|.|:...|....||..::.   ..:.:::::.|..|.:.|: .|.:...:| :.::.
 Worm   254 RVLVALWWLASITLSATFTGSLVALFAVDKTNVPFQNIDQLVRLVKQGKFEIVMDENSFTRTEMI 318

  Fly   436 YGHNSEVYRRLDAKMML-----VAEGEERLIEMVSKRGGFAGVTRSASLQL---SDIRYVMTKKV 492
            ......|||.|..:|::     ...|..|.:..|....|:|.:...|:|..   ||.:.::... 
 Worm   319 ARSKLPVYRDLWHEMIVNHKVKYVNGIARGVAFVRANPGYALLGPMATLNFYAYSDCKVILFND- 382

  Fly   493 HKIPECPKNYHIAYVLPRPSPYLEEVNRIVLRLVAGGIVGLWTGEAKERAKWSIQRFPEYLAELD 557
            ..:|     .:::..|.:.|.|....:..:..:|..|....|.  |..|:..::|:..| .....
 Worm   383 GILP-----VYLSIPLVKNSIYSPYFSTKIREMVERGFTQKWI--ADYRSYVAMQKINE-CNSTT 439

  Fly   558 VGRWKVLTLSDVQLAFYALTIGCLLSAIVCMAEIL 592
            :|....|.|...|.||:....|..|...:.:.|.:
 Worm   440 IGPKSYLDLKRAQGAFWVFLGGAGLGLALFVGEFI 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir100aNP_651898.2 Periplasmic_Binding_Protein_Type_2 210..>255 CDD:304360 14/50 (28%)
Lig_chan <439..580 CDD:278489 31/148 (21%)
glr-8NP_001368711.1 PBP2_iGluR_ligand_binding 62..424 CDD:270219 82/372 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.