DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acf and BDF2

DIOPT Version :9

Sequence 1:NP_536734.2 Gene:Acf / 43751 FlyBaseID:FBgn0027620 Length:1476 Species:Drosophila melanogaster
Sequence 2:NP_010213.1 Gene:BDF2 / 851488 SGDID:S000002228 Length:638 Species:Saccharomyces cerevisiae


Alignment Length:241 Identity:59/241 - (24%)
Similarity:100/241 - (41%) Gaps:55/241 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1239 SDEEKVCQKCF-YDGGE--IKCVQCRLFFHLECVHLKRPPRTDFVCKTCKPMPQRPRRRHSNMNG 1300
            ||.:.:...|. ::|.|  |..:..|:..:.|......|||.         :|....::.|. |.
Yeast   202 SDFKTMVDNCLNFNGPESSISSMAKRIQKYFEKKLSAMPPRV---------LPASALKKTSR-NR 256

  Fly  1301 DHDRDEEEPKAKRPRNSLRLSIDKTARPSNGNNNNNNNNSSVNNNNHRRSGRRTNEHMPLNSAAL 1365
            ..:.|.:.|          |.|.::...:|.|...:.|...|:....:|:     .|.| .|..|
Yeast   257 KKNEDMDSP----------LVIRRSVSTTNDNIGESGNREGVSGGRPKRT-----IHPP-KSKDL 305

  Fly  1366 YDLLEQ---------------------IMKHKAA---WPFLRPV--LTSEVPDYHQIIKTPMDLA 1404
            :|:.|.                     :|..|.:   :|||:||  :...:|:|..::|.||||.
Yeast   306 FDIYENSKPKSKTLQKKFRTCLKILKVLMSKKNSDINFPFLQPVDPIALNLPNYFDVVKNPMDLG 370

  Fly  1405 KIKSKLNMGAYQLNEELLSDIQLVFRNCDLYNVEGNEIYDAGCQLE 1450
            .|.:.|....|:..::.:.|:.|||.||..:|.||||::..|.:|:
Yeast   371 TISNNLMNWKYKTIDQFVDDLNLVFYNCFQFNPEGNEVHSMGKKLK 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcfNP_536734.2 WAC_Acf1_DNA_bd 26..125 CDD:287503
DDT 346..411 CDD:214726
WHIM1 505..554 CDD:292246
WHIM2 637..666 CDD:292247
WHIM3 775..813 CDD:292248
PHD_RSF1 1064..1109 CDD:277018
PHD 1244..1284 CDD:214584 9/42 (21%)
Bromo_Acf1_like 1349..1463 CDD:99936 37/128 (29%)
BDF2NP_010213.1 COG5076 55..378 CDD:227408 45/201 (22%)
Bromodomain <344..419 CDD:413371 28/73 (38%)
Lebercilin <472..>537 CDD:406132
BET 521..576 CDD:407211
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345967
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.