DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Acf and Brd4

DIOPT Version :9

Sequence 1:	NP_536734.2	Gene:	Acf / 43751	FlyBaseID:	FBgn0027620	Length:	1476	Species:	Drosophila melanogaster
Sequence 2:	NP_001273559.1	Gene:	Brd4 / 57261	MGIID:	1888520	Length:	1401	Species:	Mus musculus

Alignment Length:	136	Identity:	44/136 - (32%)
Similarity:	73/136 - (53%)	Gaps:	9/136 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly  1327 RPSNGNNNNNNNNSSVNNNNHRRSGRRTNEHMPLNSAALYDLLEQIMKHKAAWPFLRPV--LTSE 1389
            :|:|..:.|.....:.|.|..:   |:||:...|    |..:|:.:.||:.||||.:||  :...
Mouse    36 QPANAASTNPPPPETSNPNKPK---RQTNQLQYL----LRVVLKTLWKHQFAWPFQQPVDAVKLN 93

  Fly  1390 VPDYHQIIKTPMDLAKIKSKLNMGAYQLNEELLSDIQLVFRNCDLYNVEGNEIYDAGCQLERFVI 1454
            :|||::|||||||:..||.:|....|...:|.:.|...:|.||.:||..|::|......||:..:
Mouse    94 LPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFL 158

  Fly  1455 DRCRDM 1460
            .:..::
Mouse   159 QKINEL 164

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Acf	NP_536734.2	WAC_Acf1_DNA_bd	26..125	CDD:287503
		DDT	346..411	CDD:214726
		WHIM1	505..554	CDD:292246
		WHIM2	637..666	CDD:292247
		WHIM3	775..813	CDD:292248
		PHD_RSF1	1064..1109	CDD:277018
		PHD	1244..1284	CDD:214584
		Bromo_Acf1_like	1349..1463	CDD:99936	39/114 (34%)
Brd4	NP_001273559.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..58		5/24 (21%)
		Bromo_Brdt_I_like	58..164	CDD:99929	39/109 (36%)
		Bromo_Brdt_II_like	355..456	CDD:99930
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	462..617
		NPS region. /evidence=ECO:0000250	486..505
		BID region. /evidence=ECO:0000250	526..581
		BET	611..675	CDD:407211
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	676..1126
		PHA03247	<793..1231	CDD:223021
		C-terminal (CTD) region. /evidence=ECO:0000250	1051..1401
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1156..1378
		TPH	<1267..1308	CDD:404709
		BRD4_CDT	1359..1401	CDD:407248
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C167848857
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5076
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	3	2.830