DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Acf and brd4

DIOPT Version :9

Sequence 1:	NP_536734.2	Gene:	Acf / 43751	FlyBaseID:	FBgn0027620	Length:	1476	Species:	Drosophila melanogaster
Sequence 2:	NP_001104751.1	Gene:	brd4 / 570531	ZFINID:	ZDB-GENE-030131-267	Length:	1444	Species:	Danio rerio

Alignment Length:	142	Identity:	46/142 - (32%)
Similarity:	73/142 - (51%)	Gaps:	7/142 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly  1321 SIDKTARPSNGNNNNNNNNSSVNNNNHRRSGRRTNEHMPLNSAALYDLLEQIMKHKAAWPFLRPV 1385
            |.....:||:...::.|.|.. ..:|..|..|:||:...|    |..:|:.:.||:.||||..||
Zfish    13 SSSSQGQPSSQAPSSFNPNPP-ETSNPTRPKRQTNQLQYL----LKVVLKSLWKHQFAWPFHAPV 72

  Fly  1386 --LTSEVPDYHQIIKTPMDLAKIKSKLNMGAYQLNEELLSDIQLVFRNCDLYNVEGNEIYDAGCQ 1448
              :...:|||::|||.|||:..||.:|....|...:|.:.|...:|.||.:||..|::|......
Zfish    73 DAVKLNLPDYYKIIKNPMDMGTIKKRLESAFYTSAQECIQDFNTMFTNCYIYNKPGDDIVLMAEA 137

  Fly  1449 LERFVIDRCRDM 1460
            ||:..:.:..:|
Zfish   138 LEKVFLTKISEM 149

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Acf	NP_536734.2	WAC_Acf1_DNA_bd	26..125	CDD:287503
		DDT	346..411	CDD:214726
		WHIM1	505..554	CDD:292246
		WHIM2	637..666	CDD:292247
		WHIM3	775..813	CDD:292248
		PHD_RSF1	1064..1109	CDD:277018
		PHD	1244..1284	CDD:214584
		Bromo_Acf1_like	1349..1463	CDD:99936	40/114 (35%)
brd4	NP_001104751.1	bromodomain 1; BD1	40..152		40/114 (35%)
		Bromo_Brdt_I_like	43..149	CDD:99929	38/109 (35%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	154..217
		bromodomain 2; BD2	356..473
		Bromo_Brdt_II_like	363..464	CDD:99930
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	492..523
		NPS region. /evidence=ECO:0000250	498..517
		BID region. /evidence=ECO:0000250	538..610
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	540..645
		ET domain	654..729
		BET	657..721	CDD:293640
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1020..1422
		C-terminal (CTD) region. /evidence=ECO:0000250	1126..1444
		BRD4_CDT	<1419..1444	CDD:293710
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C170594384
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5076
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	3	2.740