DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acf and Gcn5

DIOPT Version :9

Sequence 1:NP_536734.2 Gene:Acf / 43751 FlyBaseID:FBgn0027620 Length:1476 Species:Drosophila melanogaster
Sequence 2:NP_648586.2 Gene:Gcn5 / 39431 FlyBaseID:FBgn0020388 Length:813 Species:Drosophila melanogaster


Alignment Length:120 Identity:45/120 - (37%)
Similarity:62/120 - (51%) Gaps:2/120 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly  1345 NNHRRSGRRTNEHM-PLNSAALY-DLLEQIMKHKAAWPFLRPVLTSEVPDYHQIIKTPMDLAKIK 1407
            |...||.|...|.. |...|..: .:|:.:.:|..||||||||..:|||||:..||.||||..:.
  Fly   691 NRPARSSRPLEESTDPEKLATSFASVLQSVRQHTTAWPFLRPVTAAEVPDYYDHIKYPMDLKTMG 755

  Fly  1408 SKLNMGAYQLNEELLSDIQLVFRNCDLYNVEGNEIYDAGCQLERFVIDRCRDMQL 1462
            .:|..|.||.....::|:..:|.||..||....|.|.....|||:...:.|::.|
  Fly   756 ERLKKGYYQTRRLFMADMARIFSNCRFYNSPDTEYYRCANSLERYFQTKMRELGL 810

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcfNP_536734.2 WAC_Acf1_DNA_bd 26..125 CDD:287503
DDT 346..411 CDD:214726
WHIM1 505..554 CDD:292246
WHIM2 637..666 CDD:292247
WHIM3 775..813 CDD:292248
PHD_RSF1 1064..1109 CDD:277018
PHD 1244..1284 CDD:214584
Bromo_Acf1_like 1349..1463 CDD:99936 44/116 (38%)
Gcn5NP_648586.2 PCAF_N 73..322 CDD:283997
COG5076 451..807 CDD:227408 43/115 (37%)
Acetyltransf_1 526..598 CDD:278980
Bromo_gcn5_like 708..808 CDD:99941 38/99 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468242
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.