DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acf and Brd4

DIOPT Version :9

Sequence 1:NP_536734.2 Gene:Acf / 43751 FlyBaseID:FBgn0027620 Length:1476 Species:Drosophila melanogaster
Sequence 2:NP_001094373.1 Gene:Brd4 / 362844 RGDID:1307282 Length:1403 Species:Rattus norvegicus


Alignment Length:137 Identity:44/137 - (32%)
Similarity:73/137 - (53%) Gaps:7/137 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly  1326 ARPSNGNNNNNNNNSSVNNNNHRRSGRRTNEHMPLNSAALYDLLEQIMKHKAAWPFLRPV--LTS 1388
            |:|.:. |..:.|......:|..:..|:||:...|    |..:|:.:.||:.||||.:||  :..
  Rat    33 AQPQSA-NAASTNPPPPETSNPNKPKRQTNQLQYL----LRVVLKTLWKHQFAWPFQQPVDAVKL 92

  Fly  1389 EVPDYHQIIKTPMDLAKIKSKLNMGAYQLNEELLSDIQLVFRNCDLYNVEGNEIYDAGCQLERFV 1453
            .:|||::|||||||:..||.:|....|...:|.:.|...:|.||.:||..|::|......||:..
  Rat    93 NLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLF 157

  Fly  1454 IDRCRDM 1460
            :.:..::
  Rat   158 LQKINEL 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcfNP_536734.2 WAC_Acf1_DNA_bd 26..125 CDD:287503
DDT 346..411 CDD:214726
WHIM1 505..554 CDD:292246
WHIM2 637..666 CDD:292247
WHIM3 775..813 CDD:292248
PHD_RSF1 1064..1109 CDD:277018
PHD 1244..1284 CDD:214584
Bromo_Acf1_like 1349..1463 CDD:99936 39/114 (34%)
Brd4NP_001094373.1 Bromo_Brdt_I_like 58..164 CDD:99929 39/109 (36%)
Bromo_Brdt_II_like 354..455 CDD:99930
BET 610..674 CDD:293640
BRD4_CDT 1361..1403 CDD:293710
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352458
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.