DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acf and brdt

DIOPT Version :9

Sequence 1:NP_536734.2 Gene:Acf / 43751 FlyBaseID:FBgn0027620 Length:1476 Species:Drosophila melanogaster
Sequence 2:XP_002662470.2 Gene:brdt / 333996 ZFINID:ZDB-GENE-030131-5928 Length:1093 Species:Danio rerio


Alignment Length:127 Identity:39/127 - (30%)
Similarity:62/127 - (48%) Gaps:6/127 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly  1336 NNNNSSVNNNNHRRSGRRTNEHMPLNSAALYDLLEQIMKHKAAWPFLRPV--LTSEVPDYHQIIK 1398
            |.|.......|.::.||.||....:...    ::..:.||..:|||.:||  :...:|||:.|||
Zfish    13 NGNPPPPEFKNPKKPGRLTNHLQYIEKV----VIRALWKHHFSWPFRQPVDAVRLNLPDYYTIIK 73

  Fly  1399 TPMDLAKIKSKLNMGAYQLNEELLSDIQLVFRNCDLYNVEGNEIYDAGCQLERFVIDRCRDM 1460
            .||||..|:.:|....|....|.:.|...:|.||.:||..|::|......||:..:::..:|
Zfish    74 NPMDLTTIRKRLENNYYWKAMECVEDFNTMFTNCYVYNRPGDDIVLMAQVLEKLFLEKVAEM 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcfNP_536734.2 WAC_Acf1_DNA_bd 26..125 CDD:287503
DDT 346..411 CDD:214726
WHIM1 505..554 CDD:292246
WHIM2 637..666 CDD:292247
WHIM3 775..813 CDD:292248
PHD_RSF1 1064..1109 CDD:277018
PHD 1244..1284 CDD:214584
Bromo_Acf1_like 1349..1463 CDD:99936 36/114 (32%)
brdtXP_002662470.2 Bromo_Brdt_I_like 29..135 CDD:99929 34/109 (31%)
Bromo_Brdt_II_like 273..373 CDD:99930
BET 514..577 CDD:293640
BRD4_CDT 1050..1093 CDD:293710
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594391
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.