DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acf and Kat2a

DIOPT Version :9

Sequence 1:NP_536734.2 Gene:Acf / 43751 FlyBaseID:FBgn0027620 Length:1476 Species:Drosophila melanogaster
Sequence 2:XP_006247379.1 Gene:Kat2a / 303539 RGDID:1307242 Length:833 Species:Rattus norvegicus


Alignment Length:88 Identity:34/88 - (38%)
Similarity:50/88 - (56%) Gaps:0/88 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly  1365 LYDLLEQIMKHKAAWPFLRPVLTSEVPDYHQIIKTPMDLAKIKSKLNMGAYQLNEELLSDIQLVF 1429
            |.:||.||..|.:||||:.||..||.|||:::|:.|:||..:..:|....|...:..::|:|.|.
  Rat   733 LKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVI 797

  Fly  1430 RNCDLYNVEGNEIYDAGCQLERF 1452
            .||..||...:|.......||:|
  Rat   798 ANCREYNPPDSEYCRCASALEKF 820

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcfNP_536734.2 WAC_Acf1_DNA_bd 26..125 CDD:287503
DDT 346..411 CDD:214726
WHIM1 505..554 CDD:292246
WHIM2 637..666 CDD:292247
WHIM3 775..813 CDD:292248
PHD_RSF1 1064..1109 CDD:277018
PHD 1244..1284 CDD:214584
Bromo_Acf1_like 1349..1463 CDD:99936 34/88 (39%)
Kat2aXP_006247379.1 PCAF_N 81..330 CDD:283997
COG5076 488..828 CDD:227408 34/88 (39%)
Acetyltransf_1 551..623 CDD:278980
Bromo_gcn5_like 728..827 CDD:99941 34/88 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352464
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.