DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acf and Brdt

DIOPT Version :9

Sequence 1:NP_536734.2 Gene:Acf / 43751 FlyBaseID:FBgn0027620 Length:1476 Species:Drosophila melanogaster
Sequence 2:XP_006534791.1 Gene:Brdt / 114642 MGIID:1891374 Length:961 Species:Mus musculus


Alignment Length:117 Identity:43/117 - (36%)
Similarity:64/117 - (54%) Gaps:6/117 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly  1346 NHRRSGRRTNEHMPLNSAALYDLLEQIMKHKAAWPFLRPV--LTSEVPDYHQIIKTPMDLAKIKS 1408
            |.::|||.||:...|...    :|:.:.||..:|||.:||  :..::|||:.||||||||..||.
Mouse    20 NTKKSGRLTNQLQFLQRV----VLKALWKHGFSWPFQQPVDAVKLKLPDYYTIIKTPMDLNTIKK 80

  Fly  1409 KLNMGAYQLNEELLSDIQLVFRNCDLYNVEGNEIYDAGCQLERFVIDRCRDM 1460
            :|....|:...|.:.|...:|.||.|||..|::|......||:..:.:...|
Mouse    81 RLENKYYEKASECIEDFNTMFSNCYLYNKTGDDIVVMAQALEKLFMQKLSQM 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcfNP_536734.2 WAC_Acf1_DNA_bd 26..125 CDD:287503
DDT 346..411 CDD:214726
WHIM1 505..554 CDD:292246
WHIM2 637..666 CDD:292247
WHIM3 775..813 CDD:292248
PHD_RSF1 1064..1109 CDD:277018
PHD 1244..1284 CDD:214584
Bromo_Acf1_like 1349..1463 CDD:99936 42/114 (37%)
BrdtXP_006534791.1 Bromo_Brdt_I_like 26..132 CDD:99929 39/109 (36%)
Bromo_Brdt_II_like 271..372 CDD:99930
BET 505..567 CDD:374956
BRD4_CDT 919..961 CDD:374989
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848856
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.