DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acf and kat2a

DIOPT Version :9

Sequence 1:NP_536734.2 Gene:Acf / 43751 FlyBaseID:FBgn0027620 Length:1476 Species:Drosophila melanogaster
Sequence 2:XP_031750307.1 Gene:kat2a / 100492735 XenbaseID:XB-GENE-992487 Length:798 Species:Xenopus tropicalis


Alignment Length:98 Identity:33/98 - (33%)
Similarity:54/98 - (55%) Gaps:0/98 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly  1365 LYDLLEQIMKHKAAWPFLRPVLTSEVPDYHQIIKTPMDLAKIKSKLNMGAYQLNEELLSDIQLVF 1429
            |.:||.||..|.:||||:.||..||.|||:::|:.|:||..:..:|....|...:..::|:|.:.
 Frog   698 LKNLLAQIKTHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLKNRYYVTKKIFIADLQRII 762

  Fly  1430 RNCDLYNVEGNEIYDAGCQLERFVIDRCRDMQL 1462
            .||..||...::.......||:|...:.::..|
 Frog   763 TNCREYNPPDSDYCKCANTLEKFFYFKLKEAGL 795

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcfNP_536734.2 WAC_Acf1_DNA_bd 26..125 CDD:287503
DDT 346..411 CDD:214726
WHIM1 505..554 CDD:292246
WHIM2 637..666 CDD:292247
WHIM3 775..813 CDD:292248
PHD_RSF1 1064..1109 CDD:277018
PHD 1244..1284 CDD:214584
Bromo_Acf1_like 1349..1463 CDD:99936 33/98 (34%)
kat2aXP_031750307.1 PCAF_N 47..296 CDD:399460
COG5076 453..792 CDD:227408 32/93 (34%)
Bromo_gcn5_like 693..792 CDD:99941 32/93 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.