DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acf and brd2

DIOPT Version :9

Sequence 1:NP_536734.2 Gene:Acf / 43751 FlyBaseID:FBgn0027620 Length:1476 Species:Drosophila melanogaster
Sequence 2:XP_012809277.2 Gene:brd2 / 100038037 XenbaseID:XB-GENE-481598 Length:778 Species:Xenopus tropicalis


Alignment Length:178 Identity:50/178 - (28%)
Similarity:80/178 - (44%) Gaps:30/178 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly  1309 PKAKRP-----RNSLRLSIDKT-----ARPS------NGNNNNNN--------NNSSVNNNNHRR 1349
            |..|||     ...:..||:.|     .:||      .|.|..::        |......:|.::
 Frog     7 PAVKRPPLDLNHGMMGQSIEGTPGKRIRKPSLLYEDFEGPNMTSSVFHQLPQTNPPPPEFSNSKK 71

  Fly  1350 SGRRTNEHMPLNSAALYDLLEQIMKHKAAWPFLRPV--LTSEVPDYHQIIKTPMDLAKIKSKLNM 1412
            .||.||:...|:..    :::.:.||:.:|||.:||  :...:||||:|||.|||:..||.:|..
 Frog    72 PGRSTNQLQYLHKV----VMKSLWKHQFSWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKKRLEN 132

  Fly  1413 GAYQLNEELLSDIQLVFRNCDLYNVEGNEIYDAGCQLERFVIDRCRDM 1460
            ..|....|.:.|...:|.||.:||...::|......||:..:.:...|
 Frog   133 NYYWSALECMQDFNTMFTNCYIYNKPTDDIVLMAQSLEKMFLQKVAQM 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcfNP_536734.2 WAC_Acf1_DNA_bd 26..125 CDD:287503
DDT 346..411 CDD:214726
WHIM1 505..554 CDD:292246
WHIM2 637..666 CDD:292247
WHIM3 775..813 CDD:292248
PHD_RSF1 1064..1109 CDD:277018
PHD 1244..1284 CDD:214584
Bromo_Acf1_like 1349..1463 CDD:99936 37/114 (32%)
brd2XP_012809277.2 Bromo_Brdt_I_like 74..180 CDD:99929 35/109 (32%)
Bromo_Brdt_II_like 343..444 CDD:99930
BET 610..674 CDD:407211
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.