DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mccc1 and PCB

DIOPT Version :9

Sequence 1:NP_001247391.1 Gene:Mccc1 / 43750 FlyBaseID:FBgn0039877 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_001163103.1 Gene:PCB / 36020 FlyBaseID:FBgn0027580 Length:1197 Species:Drosophila melanogaster


Alignment Length:523 Identity:200/523 - (38%)
Similarity:299/523 - (57%) Gaps:23/523 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RLLRNFGANAR---CFATEASPKV--RPISKILISNRGEIACRVIRTARKLGVRTVAVFSDPDEK 63
            |.||......|   .|....|.||  :||..:|::||||||.||.|...:||:::|||:|:.|:.
  Fly    11 RTLRKTQPRVRLNAIFKNGYSSKVEYKPIRSVLVANRGEIAIRVFRACTELGIKSVAVYSEQDKM 75

  Fly    64 SMHTQLADESYRVGEAASSA-SYLRGERILDIAKRSGAQAIHPGYGFLSESVEFAELCQREGIIF 127
            .||.|.|||||.||:..... :||....::.:.|.:...|:|||||||||..:||:.....|:.|
  Fly    76 HMHRQKADESYIVGKGLPPVEAYLNIPELIRVCKENDVDAVHPGYGFLSERSDFAQAVIDAGLRF 140

  Fly   128 MGPPSSAIRDMGIKSTSKAIMAAAGVPIINGYHGDDQSDECLQREADKIGFPLMIKAVRGGGGKG 192
            :||....::.||.|..::.....|||||:.|..|...:.|.......|.|.|::.||..||||:|
  Fly   141 IGPSPEVVQKMGDKVAARVAAIEAGVPIVPGTDGPVTTKEEALEFCKKHGLPVIFKAAYGGGGRG 205

  Fly   193 MRIAEKPDDFLTALNSARTESEKSFGDSSVLLERYVRSPRHVEVQVFADQYGDAVYLWERDCSVQ 257
            ||:..|.:|...:...|.:|::.:||:.::.:|:::..|||:|||:..|:.|:.|:|:|||||||
  Fly   206 MRVVRKMEDVEESFQRASSEAKAAFGNGAMFIEKFIERPRHIEVQLLGDKAGNVVHLYERDCSVQ 270

  Fly   258 RRHQKIIEEAPAPGLSEDLRRELGEAAVRAAKAVGYVGAGTVEFILDKEDLSFHFMEMNTRLQVE 322
            |||||::|.||||.|..::|.::.|||||.|:.|||..||||||:.| |..:|:|:|:|.|||||
  Fly   271 RRHQKVVEIAPAPRLPIEIRDKMTEAAVRLARHVGYENAGTVEFLCD-ESGNFYFIEVNARLQVE 334

  Fly   323 HPITEMITGTDLVEWQIRIAAGEPLP---LKQSEITRRGHAFEARIYAENPRGGFLPGAGPLRYL 384
            |.:||.|||.|||:.|||:|.|..||   ..|.:|..||:|.:.|:..|:|...|.|..|.|...
  Fly   335 HTVTEEITGIDLVQSQIRVAEGMTLPELGYTQDKIVPRGYAIQCRVTTEDPANDFQPNTGRLEVF 399

  Fly   385 STPQPSNNVRVET-GVREGDEVSVHYDPMIAKLVVWGENRTQALNSLVARLGEYHISGLDTNINF 448
            .:.: ...:|::: ....|..:|.:||.::.|::....:...:.:.:...|.|:.|.|:.|||.|
  Fly   400 RSGE-GMGIRLDSASAYAGAIISPYYDSLLVKVISHASDLQSSASKMNRALREFRIRGVKTNIPF 463

  Fly   449 LIDLASHPEFQLANVHTGFIDEQFDTL-FPPIIISPQQVSQAALALVLNELQAAFRNGNKDQDPF 512
            |:::..:.:|....:.|.||||..... |.|.:...|:        :||.:.....||  .|.|.
  Fly   464 LLNVLENQKFLHGVLDTYFIDEHPQLFKFKPSLNRAQK--------LLNYMGEVLVNG--PQTPL 518

  Fly   513 VAT 515
            ..|
  Fly   519 ATT 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mccc1NP_001247391.1 PccA 27..693 CDD:227111 191/495 (39%)
CPSase_L_chain 27..135 CDD:278706 47/108 (44%)
CPSase_L_D2 141..348 CDD:280881 97/206 (47%)
Biotin_carb_C 362..469 CDD:214878 25/107 (23%)
biotinyl_domain 626..691 CDD:133459
PCBNP_001163103.1 CPSase_L_chain 39..147 CDD:278706 47/107 (44%)
pyruv_carbox 41..1197 CDD:130302 190/493 (39%)
ATP-grasp_4 153..360 CDD:302634 97/207 (47%)
Biotin_carb_C 377..484 CDD:214878 25/107 (23%)
DRE_TIM_PC_TC_5S 584..867 CDD:163675
PYC_OADA 880..1078 CDD:280576
biotinyl_domain 1130..1196 CDD:133459
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438209
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D130620at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.