DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment faf and not

DIOPT Version :9

Sequence 1:NP_524612.2 Gene:faf / 43749 FlyBaseID:FBgn0005632 Length:2778 Species:Drosophila melanogaster
Sequence 2:NP_001287106.1 Gene:not / 40030 FlyBaseID:FBgn0013717 Length:496 Species:Drosophila melanogaster


Alignment Length:457 Identity:102/457 - (22%)
Similarity:156/457 - (34%) Gaps:158/457 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly  1662 RP--TKGFCGLKNAGATCYMNSVLQQLYMVPAVRVGILRAHGAATTDGEDFSGDSDLTGGGLGSA 1724
            ||  |.|..||.|.||||:||.::|                                        
  Fly   150 RPNQTIGLRGLLNLGATCFMNCIVQ---------------------------------------- 174

  Fly  1725 LFSGPASALVSLPSSSSTIEDGLHDV-RKNYHVVILKHVQAIFAHL---GHSALQYY-VPRGLWT 1784
                   |||..|..|.......||. .|:.|..::..|..:|...   ..|.|..: :...:|.
  Fly   175 -------ALVHTPLLSDYFMSDRHDCGSKSSHKCLVCEVSRLFQEFYSGSRSPLSLHRLLHLIWN 232

  Fly  1785 HFKLLGEPVNLREQQDAVEFFMSLLESLDEG-LKALGQPQLMNATLG------------------ 1830
            |.|.|..    .|||||.|||::.|:.|... :||..:.:..:.:.|                  
  Fly   233 HAKHLAG----YEQQDAHEFFIATLDVLHRHCVKAKAEHESKSNSSGSGSGTNSSNSSSSHCYGQ 293

  Fly  1831 ----------GSFSDQKICQECPHRYSKEEPFSVFSVDI---RNHSSLT-----ESLEQYVKGEL 1877
                      |......:||.|....:..:||...|:|:   ..|..:|     :.||:|.:.|.
  Fly   294 CNCIIDQIFTGMLQSDVVCQACNGVSTTYDPFWDISLDLGETTTHGGVTPKTLIDCLERYTRAEH 358

  Fly  1878 LEGADAYHCDKCDKKVVTVKRVCVKKLPPVLAIQLKRFEYD--YERVCAIKFNDYFEFPRILDME 1940
            |..|....|..|.....:.|:..::.||.|::..|||||:.  .:|    |.:.:.:||...||.
  Fly   359 LGSAAKIKCSTCKSYQESTKQFSLRTLPSVVSFHLKRFEHSALIDR----KISSFIQFPVEFDMT 419

  Fly  1941 PYTVSGLAKLEGEVVEVGDNCQTNVETTKYELTGIVVHSGQASGGHYFSYILSKNPANGKCQWYK 2005
            |:       :..:....||        .::.|..:|.|.|....|||.:|:     .:.|..|.|
  Fly   420 PF-------MSEKKNAYGD--------FRFSLYAVVNHVGTIDTGHYTAYV-----RHQKDTWVK 464

  Fly  2006 FDDGEVTECKMHE--DEEMKAECFGGEYMGETYDNNLKRMQYRRQKRWWNAYMLFYTRCDQTPVQ 2068
            .||..:|...:.:  |.|                                .|:|||   .:..::
  Fly   465 CDDHVITMASLKQVLDSE--------------------------------GYLLFY---HKNVLE 494

  Fly  2069 YE 2070
            ||
  Fly   495 YE 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fafNP_524612.2 peptidase_C19C 1666..2064 CDD:239124 97/443 (22%)
UCH 1668..2059 CDD:278850 94/436 (22%)
notNP_001287106.1 zf-UBP 46..103 CDD:307999
Peptidase_C19D 158..489 CDD:239125 96/440 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456864
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.