DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment faf and scny

DIOPT Version :9

Sequence 1:NP_524612.2 Gene:faf / 43749 FlyBaseID:FBgn0005632 Length:2778 Species:Drosophila melanogaster
Sequence 2:NP_729092.1 Gene:scny / 38648 FlyBaseID:FBgn0260936 Length:1038 Species:Drosophila melanogaster


Alignment Length:383 Identity:95/383 - (24%)
Similarity:140/383 - (36%) Gaps:99/383 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  1651 REWDYLPPVGARPTKGFCGLKNAGATCYMNSVLQQLYMVPAVRVGIL--RAHGAATTDGEDFSGD 1713
            |:|.    ||.       |:.|.|.|||:||.||.|..:||:...::  :||.|.....|..|| 
  Fly   166 RKWQ----VGT-------GMINVGNTCYLNSTLQALLHIPALANWLVSEQAHLADCNVAEPGSG- 218

  Fly  1714 SDLTGGGLGSALFSGPASALVSLPSSSSTIEDGLHDVRKNYHVVILKHVQAIFAHLGHSALQYYV 1778
                      .:.......|::..|:.|.:...|          |...::.|..|:         
  Fly   219 ----------CIICAMTKTLLATQSNQSAVRPFL----------IYSKLKQICKHM--------- 254

  Fly  1779 PRGLWTHFKLLGEPVNLREQQDAVEFFMSLLESLD-------EGLKALGQPQLMNAT------LG 1830
                     ::|      .|:||.||...|:|:::       ...|.|  .||:..|      .|
  Fly   255 ---------VVG------RQEDAHEFLRFLVEAMERAYLMRFRNYKEL--DQLVKETTPLGQIFG 302

  Fly  1831 GSFSDQKICQECPHRYSKEEPFSVFSVDIRNHSSLTESLEQYVKGELLEGADAYHCDKCDKKVVT 1895
            |....:..|..|.|.....:.|....:|||...||.::.|.:...|.||.. .|.|:.|.|||..
  Fly   303 GYLRSEVRCLSCNHVSITFQHFQDLLLDIRKADSLEDAFEGHFSRERLEDM-GYKCEGCKKKVSA 366

  Fly  1896 VKRVCVKKLPPVLAIQLKRFEYDYERVCAIKFNDYFEFPRILDMEPYTVSGLAKLEGEVVEVGDN 1960
            .|:..:::.|..|.||||||.     :...|......|...:|:..|.....|            
  Fly   367 TKQFSLERAPITLCIQLKRFS-----MIGNKLTKQISFKSRIDLSKYAARSQA------------ 414

  Fly  1961 CQTNVETTKYELTGIVVHSGQASG-GHYFSYILSKNPANGKCQWYKFDDGEVTECKMH 2017
              ...:...|.|..:|.|.|.:.. ||| :.|.|.:..:    :|.|||..|....||
  Fly   415 --AQAQPLTYRLVSMVTHLGASQHCGHY-TAIGSTDTGS----FYNFDDSYVRPIAMH 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fafNP_524612.2 peptidase_C19C 1666..2064 CDD:239124 91/368 (25%)
UCH 1668..2059 CDD:278850 91/366 (25%)
scnyNP_729092.1 Peptidase_C19E 171..477 CDD:239126 92/374 (25%)
UCH 172..477 CDD:278850 91/373 (24%)
Asp-B-Hydro_N <617..>731 CDD:191249
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456880
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24006
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.