DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment faf and Usp5

DIOPT Version :9

Sequence 1:NP_524612.2 Gene:faf / 43749 FlyBaseID:FBgn0005632 Length:2778 Species:Drosophila melanogaster
Sequence 2:NP_001246589.1 Gene:Usp5 / 38375 FlyBaseID:FBgn0035402 Length:827 Species:Drosophila melanogaster


Alignment Length:380 Identity:79/380 - (20%)
Similarity:140/380 - (36%) Gaps:128/380 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly  1632 MKLLTNTLIDFVCTDTDPLREW-------DYLPPVGARPTKGFCGLKNAGATCYMNSVLQQLYMV 1689
            ||....::::........:.||       ..|.|| |.|  |:.|::|.|.:||:|||:|.|:::
  Fly   292 MKKSEKSMVELELDINQRIGEWTALTESESELQPV-AGP--GYTGMRNLGNSCYINSVMQVLFVI 353

  Fly  1690 PAVR---VGILRAHGAATTDGE---DFSGDSDLTGGGLGSALFSGPASALV--SLPSSSSTIEDG 1746
            |..:   ||.    ||.....|   |.:.|.::....||:.|.||..|::.  :|.:..||   |
  Fly   354 PDFQQRFVGT----GAERYFKEFPSDPANDFNIQMAKLGTGLQSGKYSSIAENTLDTDHST---G 411

  Fly  1747 LHDVRKNYHVVILKHVQAIFAHLGHSALQYYVPRGLWTHFKLLGE---PVNLREQQDAVEFFMSL 1808
            :.              .|:|.:                   ::|:   ..:.::||||.:|::.|
  Fly   412 IS--------------PAMFKN-------------------IVGKNHPDFSTKQQQDANDFYLHL 443

  Fly  1809 LESLD----------EGLKALGQPQLMNATLGGSFSDQKICQEC--PH--RYSKEEPFS------ 1853
            |..||          :.||.|.:.::                ||  .|  :|:..|.:|      
  Fly   444 LTLLDRNSRNQTNPADALKFLLEDRV----------------ECLASHKVKYNTREEYSFRLPVP 492

  Fly  1854 ---VFSVD------------------------IRNHSSLTESLEQYVKGELLEGADAYHCDKCDK 1891
               ..::|                        :|:...|...||::...||:|   .::......
  Fly   493 LDKATNLDEVREFQERKKAARETGQRLPDRDIVRHKVPLQACLERFFGPELIE---QFYSTAIGS 554

  Fly  1892 KVVTVKRVCVKKLPPVLAIQLKRFEYDYERVCAIKFNDYFEFPRILDMEPYTVSG 1946
            |....|...:..:|..|.|.:.:|....:.| ..|.:...:.|..||:..:..:|
  Fly   555 KTNARKITRLATMPDCLMIHVGKFTLGDDWV-PKKLDVSVDMPDELDLSNWRSAG 608

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fafNP_524612.2 peptidase_C19C 1666..2064 CDD:239124 70/339 (21%)
UCH 1668..2059 CDD:278850 69/337 (20%)
Usp5NP_001246589.1 UBP14 24..825 CDD:227532 79/380 (21%)
zf-UBP 204..278 CDD:280334
Peptidase_C19B 333..823 CDD:239123 69/336 (21%)
UBA1_UBP5_like 631..674 CDD:270480
UBA2_UBP5 696..737 CDD:270569
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456914
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24006
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.