DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment faf and Usp14

DIOPT Version :9

Sequence 1:NP_524612.2 Gene:faf / 43749 FlyBaseID:FBgn0005632 Length:2778 Species:Drosophila melanogaster
Sequence 2:NP_001260321.1 Gene:Usp14 / 34387 FlyBaseID:FBgn0032216 Length:475 Species:Drosophila melanogaster


Alignment Length:478 Identity:111/478 - (23%)
Similarity:166/478 - (34%) Gaps:161/478 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly  1656 LPPVGARPTKGF---------------CGLKNAGATCYMNSVLQQLYMVPAVRVGILRAHGAATT 1705
            :|.|.|.|.|..               .||.|.|.|||||:.:|.|..||.:|..:         
  Fly    77 VPEVPATPVKFIEDMNEAEAATAMRLPAGLTNLGNTCYMNATVQCLNAVPELRTAL--------- 132

  Fly  1706 DGEDFSGDSDLTGGGLGSALFSGPASALVSLPSSSSTIEDGLHDVRKNYHVVILKHVQAIFAHLG 1770
              ..||.|    |....|..|           |.||.::.....:.|...|..:..:||:     
  Fly   133 --STFSND----GTDTMSTAF-----------SISSAMKSIFAQMEKGTTVTPIVLLQAL----- 175

  Fly  1771 HSALQYYVPRGLWTHFKLLGEPVNLREQQDAVEFFMSLLESLDEGLKALGQ----------PQLM 1825
            |.|.         ..|...||....| ||||.|.:..:|:.|.:.|:...|          ...:
  Fly   176 HRAS---------PQFAQTGENGTYR-QQDANECWAEILKMLQQKLRPKNQEPSNTVQKRHSSFI 230

  Fly  1826 NATLGGSFSDQKICQECPHRYSKEEPFSV-----------FSVDIRNHSSLTES--LEQYVKGEL 1877
            :...||:|..:...:|.|     :||.:|           .|:|::...|..:|  .||.||...
  Fly   231 DQFFGGTFEVKMSSEEDP-----DEPSTVTSENFLQLSCFISMDVKYMQSGLKSKMKEQLVKKSE 290

  Fly  1878 LEGADAYHCDKCDKKVVTVKRVCVKKLPPVLAIQLKRFEYDYERVCAIKFNDYFEFPRILDMEPY 1942
            ..|.||.:          ::...|.:||..|.:|..||:|..:.....|.....:||  :|.:.:
  Fly   291 TLGRDAKY----------IRTYLVSRLPAYLTVQFVRFQYKGKEGINAKVLKDIKFP--IDFDAF 343

  Fly  1943 TV-------------SGLAKLEGEVVEVGDNCQTN-----VETTKYE-----------------L 1972
            .:             |....||.:.:|| |..:.|     .:..|||                 |
  Fly   344 ELCTPELQNKLCPMRSKFKDLEDKKMEV-DVVKRNEPNEEKKDVKYEQFWFDDDLGSNNSGYYTL 407

  Fly  1973 TGIVVHSGQ-ASGGHYFSYILSKNPANGKCQWYKFDDGEVTECKMHEDEEMKAECFGGEYMGETY 2036
            ..::.|.|: :|.|||.:::.|....     |:||||.||:.....|...:..   ||:      
  Fly   408 QAVLTHKGRSSSSGHYVAWVRSSGDV-----WFKFDDDEVSAVATDEILRLSG---GGD------ 458

  Fly  2037 DNNLKRMQYRRQKRWWNAYMLFY 2059
                          |..||:|.|
  Fly   459 --------------WHCAYVLLY 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fafNP_524612.2 peptidase_C19C 1666..2064 CDD:239124 106/468 (23%)
UCH 1668..2059 CDD:278850 105/449 (23%)
Usp14NP_001260321.1 UBQ 4..73 CDD:214563
UBQ 5..73 CDD:294102
UCH 103..467 CDD:278850 105/450 (23%)
Peptidase_C19A 105..467 CDD:239122 105/448 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456919
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.