powered by:
Protein Alignment sip3 and AT1G68180
DIOPT Version :9
Sequence 1: | NP_001263152.1 |
Gene: | sip3 / 43747 |
FlyBaseID: | FBgn0039875 |
Length: | 626 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001319343.1 |
Gene: | AT1G68180 / 843146 |
AraportID: | AT1G68180 |
Length: | 235 |
Species: | Arabidopsis thaliana |
Alignment Length: | 71 |
Identity: | 24/71 - (33%) |
Similarity: | 40/71 - (56%) |
Gaps: | 5/71 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 263 SRRAIRNMNTLYPDATPEELRQSDNICIICRE--DMVNHSKKLPCGHIFHTTCLRSWFQRQQTCP 325
|:.||..:.|:. .|.|:| ..:.:|.||:| ::....|:|.|.|::|::|:.||.....|||
plant 115 SQSAIEAVRTVI--ITDEDL-VKEKVCAICKEEFEVGEEGKELKCLHLYHSSCIVSWLNIHNTCP 176
Fly 326 TCRLNI 331
.||..:
plant 177 ICRFEV 182
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
sip3 | NP_001263152.1 |
HRD1 |
20..>365 |
CDD:227568 |
24/71 (34%) |
zf-RING_2 |
287..328 |
CDD:290367 |
15/42 (36%) |
AT1G68180 | NP_001319343.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.