DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sip3 and RMR1

DIOPT Version :9

Sequence 1:NP_001263152.1 Gene:sip3 / 43747 FlyBaseID:FBgn0039875 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_201417.1 Gene:RMR1 / 836748 AraportID:AT5G66160 Length:310 Species:Arabidopsis thaliana


Alignment Length:148 Identity:38/148 - (25%)
Similarity:59/148 - (39%) Gaps:38/148 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 YTELVIGLIKVVLYILFVVIMAKIYALPMFVFRPMFFTIRNFRKALNDVIMSRRAIRNMNTLYPD 276
            :|.|.|....::|.:.|::|              .||..|::.:...         |:..|:..|
plant   167 WTVLAISFFSLLLIVTFLLI--------------AFFAPRHWTQWRG---------RHTRTIRLD 208

  Fly   277 A-----------TPEELRQSDNICIICRED--MVNHSKKLPCGHIFHTTCLRSWFQRQQT-CPTC 327
            |           |.....::...|.||.||  .....:.|||.|.||..|:.||..:..| ||.|
plant   209 AKLVHTLPCFTFTDSAHHKAGETCAICLEDYRFGESLRLLPCQHAFHLNCIDSWLTKWGTSCPVC 273

  Fly   328 RLNILRTPTVNSTAMPRQ 345
            :.:| ||.|::|....|:
plant   274 KHDI-RTETMSSEVHKRE 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sip3NP_001263152.1 HRD1 20..>365 CDD:227568 38/148 (26%)
zf-RING_2 287..328 CDD:290367 17/43 (40%)
RMR1NP_201417.1 PA_C_RZF_like 28..166 CDD:239038
RING 231..277 CDD:238093 18/45 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.