DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sip3 and AT5G37250

DIOPT Version :9

Sequence 1:NP_001263152.1 Gene:sip3 / 43747 FlyBaseID:FBgn0039875 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_001330830.1 Gene:AT5G37250 / 833699 AraportID:AT5G37250 Length:208 Species:Arabidopsis thaliana


Alignment Length:102 Identity:34/102 - (33%)
Similarity:52/102 - (50%) Gaps:15/102 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 PMFFTIRNFRKALNDVIMSRRAIRNMNT---LYPDATPE--EL-RQSDNICIICREDM-VNHSKK 302
            |..|::..:.:...||:.|..|:|:.:|   |..:.|.|  :| .:.:..|.||.||. .:|...
plant   103 PQPFSVSLYVEVTRDVMFSSIAVRSTDTFQRLLEEQTMELTDLGDEEETTCSICLEDFSESHDDN 167

  Fly   303 ---LP-CGHIFHTTCLRSWFQRQQTCPTCRLNILRTP 335
               || |.|:||..|:..|.:||::||.||    |.|
plant   168 IILLPDCFHLFHQNCIFEWLKRQRSCPLCR----RVP 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sip3NP_001263152.1 HRD1 20..>365 CDD:227568 34/102 (33%)
zf-RING_2 287..328 CDD:290367 18/45 (40%)
AT5G37250NP_001330830.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.