powered by:
Protein Alignment sip3 and AT5G08139
DIOPT Version :9
Sequence 1: | NP_001263152.1 |
Gene: | sip3 / 43747 |
FlyBaseID: | FBgn0039875 |
Length: | 626 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_850790.1 |
Gene: | AT5G08139 / 830709 |
AraportID: | AT5G08139 |
Length: | 376 |
Species: | Arabidopsis thaliana |
Alignment Length: | 66 |
Identity: | 21/66 - (31%) |
Similarity: | 36/66 - (54%) |
Gaps: | 11/66 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 279 PEELRQSDN------ICIICREDM--VNHSKKLPCGHIFHTTCLRSWFQRQQTCPTCRLNILRTP 335
|..|.:.:| :|.:|:::| .|.:.:|||.|.:|:.|:..|.:.:.|||.||..: |
plant 293 PVVLLEGENDDDGGLVCAVCKDEMNIGNKAVQLPCNHKYHSECIVPWLKVRNTCPVCRYEL---P 354
Fly 336 T 336
|
plant 355 T 355
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.