DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sip3 and AT5G05910

DIOPT Version :10

Sequence 1:NP_651894.3 Gene:sip3 / 43747 FlyBaseID:FBgn0039875 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_196210.1 Gene:AT5G05910 / 830476 AraportID:AT5G05910 Length:151 Species:Arabidopsis thaliana


Alignment Length:53 Identity:20/53 - (37%)
Similarity:25/53 - (47%) Gaps:8/53 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 CIICREDMV---NHSKKL-----PCGHIFHTTCLRSWFQRQQTCPTCRLNILR 333
            |.||.||:.   |...|:     .|.|.||..|:.||.:..|.||.||..:.|
plant    92 CPICLEDLKKVDNDDDKVVVCLSKCNHSFHMNCIFSWLRESQDCPICRSTVYR 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sip3NP_651894.3 HRD1 20..>365 CDD:227568 20/53 (38%)
AT5G05910NP_196210.1 RING_Ubox 91..139 CDD:473075 17/46 (37%)

Return to query results.
Submit another query.