DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sip3 and AT4G35840

DIOPT Version :9

Sequence 1:NP_001263152.1 Gene:sip3 / 43747 FlyBaseID:FBgn0039875 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_001329491.1 Gene:AT4G35840 / 829738 AraportID:AT4G35840 Length:268 Species:Arabidopsis thaliana


Alignment Length:268 Identity:59/268 - (22%)
Similarity:101/268 - (37%) Gaps:79/268 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 DFMER---------SPVLGWL-------FHIRVGSLLTVLGILDYVLLIHAYNSTLVRGPTVQLV 171
            :|:||         |.|||.:       |...||   |:||.|...|:.....|..:||..|..:
plant    21 NFIERIKDACRFTLSAVLGTILSAVLTFFFALVG---TLLGALTGALIGQETESGFIRGAAVGAI 82

  Fly   172 FGFEYAILLTVIASTAIKYVLHAAEMRTDTPWE-NKAVF--LLY-TELVIGLIKVVLY------I 226
            .|..::|  .|..|:.:.             |: |::.|  ||| .::::.||...|.      .
plant    83 SGAVFSI--EVFESSLVL-------------WKSNESRFGCLLYLIDVIVSLISGRLVRERIGPA 132

  Fly   227 LFVVIMAKIYAL-PMFVFRPMFFTIRNFRKALND------------------------------V 260
            :...:.:::.|: ..|......|.....:....|                              |
plant   133 MLSAVQSQMGAVDSTFEELSSIFDTGGSKGLTGDLVDKIPKIKITGKNNLDASGNKDSCSVCLQV 197

  Fly   261 IMSRRAIRNMNTLYPDATPEELRQSDNICIICREDMVNHS-KKLP-CGHIFHTTCLRSWFQRQQT 323
            ..|.:..||:|:  |:|.|:.|.....:|...::..:..: :.|| |.|:||..|:.:|..|..:
plant   198 FCSFQLKRNLNS--PNAEPKGLVLDLLLCNFLQDFQLGETVRSLPHCHHMFHLPCIDNWLFRHGS 260

  Fly   324 CPTCRLNI 331
            ||.||.::
plant   261 CPMCRRDL 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sip3NP_001263152.1 HRD1 20..>365 CDD:227568 59/268 (22%)
zf-RING_2 287..328 CDD:290367 12/42 (29%)
AT4G35840NP_001329491.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.