DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sip3 and chfr

DIOPT Version :9

Sequence 1:NP_001263152.1 Gene:sip3 / 43747 FlyBaseID:FBgn0039875 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_001093485.1 Gene:chfr / 564271 ZFINID:ZDB-GENE-030131-3522 Length:637 Species:Danio rerio


Alignment Length:57 Identity:20/57 - (35%)
Similarity:30/57 - (52%) Gaps:1/57 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 ATPEELRQSDNICIICREDMVNHSKKLPCGHIFHTTCLRSWFQRQQTCPTCRLNILR 333
            ||.:::.:| ..||||::.:.:.....||.|.|...|...|.:|...|||||..:.|
Zfish   266 ATTDKMEES-LTCIICQDLLYDCISVQPCMHTFCAACYSGWMERSSFCPTCRCPVER 321

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
sip3NP_001263152.1 HRD1 20..>365 CDD:227568 20/57 (35%)
zf-RING_2 287..328 CDD:290367 14/40 (35%)
chfrNP_001093485.1 FHA 10..98 CDD:238017
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..172