| Sequence 1: | NP_001263152.1 | Gene: | sip3 / 43747 | FlyBaseID: | FBgn0039875 | Length: | 626 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001154816.1 | Gene: | CHFR / 55743 | HGNCID: | 20455 | Length: | 664 | Species: | Homo sapiens |
| Alignment Length: | 229 | Identity: | 51/229 - (22%) |
|---|---|---|---|
| Similarity: | 78/229 - (34%) | Gaps: | 69/229 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 257 LNDVIMSRRAIRNMNTLYPD-----ATPEELRQSDNICIICREDMVNHSKKL-PCGHIFHTTCLR 315
Fly 316 SWFQRQQTCPTCRL---NILRTPTVNSTAMPRQGDEAVAAAAGNPIPAAAGVQPAGGVPPPAPTA 377
Fly 378 VVDGNQARADV------NVAGGQALPPNFADLFGDASGLPNGLPNLAGLQIPPPPVMPMISPFMI 436
Fly 437 -------------PPHFGYLTPLP--PPPIPQDL 455 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| sip3 | NP_001263152.1 | HRD1 | 20..>365 | CDD:227568 | 29/116 (25%) |
| zf-RING_2 | 287..328 | CDD:290367 | 16/41 (39%) | ||
| CHFR | NP_001154816.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..21 | ||
| FHA | 16..105 | CDD:238017 | |||
| FHA | <31..140 | CDD:224630 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 142..267 | ||||
| RING | 303..346 | CDD:238093 | 18/43 (42%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 388..417 | 7/28 (25%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 439..461 | 9/23 (39%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG5243 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||