DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sip3 and CG13605

DIOPT Version :9

Sequence 1:NP_001263152.1 Gene:sip3 / 43747 FlyBaseID:FBgn0039875 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_651214.2 Gene:CG13605 / 42858 FlyBaseID:FBgn0039150 Length:669 Species:Drosophila melanogaster


Alignment Length:333 Identity:71/333 - (21%)
Similarity:122/333 - (36%) Gaps:125/333 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 HWLAEERV-----DFMERSPVLGWLF------HIRVGSLLTVLGILD-YVLLIHAYN-STLVRGP 166
            |.::::.|     .|:...|::..||      |:        |||:| .||....|| :..||..
  Fly   336 HLISDDMVVQILSHFVRYLPLIFILFFKFLHDHL--------LGIVDLLVLQTVMYNVNRSVRNQ 392

  Fly   167 TVQLVFGFEYAILL--TVIASTAIKYVLHAAEMRTD-----TPWENKAVF--------------- 209
            ..:|. ...||:::  |.:.:..:...|..|....|     .|...|:||               
  Fly   393 VARLA-QKNYAVMVRDTFLVAVVVTVRLFLATSPPDPFGLIVPPSRKSVFIEVTALPFHTSSEGD 456

  Fly   210 ----------------------------LLY----TELVIGLIKVVLYILFVV---------IMA 233
                                        |||    ::|:|.|:.:::.::..:         :.|
  Fly   457 SPTTSSEPIKTNMYKDTYKSLNVIPLGMLLYYIAVSDLIIKLLTMLVKLIITMLPHHLMRLKVRA 521

  Fly   234 KIYALPMFV-------------------------------FRPMFFTIRNFR-----KALNDVIM 262
            ::|.|..::                               |..|:...:.|.     |:|...|:
  Fly   522 RLYVLVEYISQFYRAMTPITQWLLFLYESYSGLEVVSGGLFSAMYLGAKIFELVERGKSLKKAIV 586

  Fly   263 SRRAIRNMNTLYPDATPEELRQSDNICIICREDMVNHSKKLPCGHIFHTTCLRSWFQRQQTCPTC 327
            :.|  :|:::..| .|.:||..:..:|.|| .|..|....|.|||||...|:::||:|:||||.|
  Fly   587 TFR--KNIDSERP-PTKDELDAAGALCPIC-HDAFNTPTVLECGHIFCDECVQTWFKREQTCPMC 647

  Fly   328 RLNILRTP 335
            |..:...|
  Fly   648 RAKVSDDP 655

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sip3NP_001263152.1 HRD1 20..>365 CDD:227568 71/333 (21%)
zf-RING_2 287..328 CDD:290367 19/40 (48%)
CG13605NP_651214.2 RING 610..651 CDD:238093 21/41 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5243
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D897451at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.