DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sip3 and CG6923

DIOPT Version :9

Sequence 1:NP_001263152.1 Gene:sip3 / 43747 FlyBaseID:FBgn0039875 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_001262484.1 Gene:CG6923 / 41420 FlyBaseID:FBgn0037944 Length:1265 Species:Drosophila melanogaster


Alignment Length:103 Identity:29/103 - (28%)
Similarity:45/103 - (43%) Gaps:25/103 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 PEELRQSDNICIICRE--DMVNHSKKLPCGHIFHTTCLRSWFQRQQTCPTCRLNILRTPTVNSTA 341
            |.|..:....|.||..  ::.|..::|||.|:|||.|:..|....:.||.||::|       .|.
  Fly  1177 PSETDEDAEKCAICLNLFEIENEVRRLPCMHLFHTDCVDQWLVTNKHCPICRVDI-------ETH 1234

  Fly   342 MPRQGDEAVAAAAGNPIPAAAGVQPAGGVPPPAPTAVV 379
            ||           .:.:|.:     :.|||..|.:|.:
  Fly  1235 MP-----------NDALPPS-----SSGVPDAANSAAL 1256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sip3NP_001263152.1 HRD1 20..>365 CDD:227568 24/87 (28%)
zf-RING_2 287..328 CDD:290367 15/42 (36%)
CG6923NP_001262484.1 zf-rbx1 <1185..1228 CDD:289448 15/42 (36%)
zf-RING_2 1187..1228 CDD:290367 15/40 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.