DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sip3 and Chfr

DIOPT Version :9

Sequence 1:NP_001263152.1 Gene:sip3 / 43747 FlyBaseID:FBgn0039875 Length:626 Species:Drosophila melanogaster
Sequence 2:XP_006249597.1 Gene:Chfr / 288734 RGDID:1306360 Length:664 Species:Rattus norvegicus


Alignment Length:206 Identity:48/206 - (23%)
Similarity:66/206 - (32%) Gaps:54/206 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 PDATPEELRQSDNICIICREDMVNHSKKL-PCGHIFHTTCLRSWFQRQQTCPTCRL---NILRTP 335
            ||...|.|     .|||| :|:::....| ||.|.|...|...|.:|...|||||.   .|.:..
  Rat   294 PDKMEETL-----TCIIC-QDLLHDCVSLQPCMHTFCAACYSGWMERSSLCPTCRCPVERICKNH 352

  Fly   336 TVNSTAMPRQGDEAVAAAAGNPIPAAAGVQPAGGVPPPAPTAVVDGNQARADV------NVAGGQ 394
            .:|                 |.:.|.....|             |.:::..||      |.....
  Rat   353 ILN-----------------NLVEAYLLQHP-------------DKSRSEEDVRSMDARNKITQD 387

  Fly   395 ALPPNFADLFGDASGLPNGLPNLAGLQIPPPPV-MPMISPFMIPPHFGYLTPLPPPPIPQDLTNF 458
            .|.|.....|.|..|....|..|:.:......: .|.|.....|.:........|.|:|      
  Rat   388 MLQPKVRRSFSDEEGSSEDLLELSDVDSESSDISQPYIVCRQCPEYRRQAVQSLPCPVP------ 446

  Fly   459 TDEELRAMEGL 469
             :.||.|.:.|
  Rat   447 -ESELGATQAL 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sip3NP_001263152.1 HRD1 20..>365 CDD:227568 26/93 (28%)
zf-RING_2 287..328 CDD:290367 16/41 (39%)
ChfrXP_006249597.1 FHA 16..105 CDD:238017
FHA <27..140 CDD:224630
RING 302..345 CDD:238093 18/43 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5243
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.