Sequence 1: | NP_001263152.1 | Gene: | sip3 / 43747 | FlyBaseID: | FBgn0039875 | Length: | 626 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006249597.1 | Gene: | Chfr / 288734 | RGDID: | 1306360 | Length: | 664 | Species: | Rattus norvegicus |
Alignment Length: | 206 | Identity: | 48/206 - (23%) |
---|---|---|---|
Similarity: | 66/206 - (32%) | Gaps: | 54/206 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 275 PDATPEELRQSDNICIICREDMVNHSKKL-PCGHIFHTTCLRSWFQRQQTCPTCRL---NILRTP 335
Fly 336 TVNSTAMPRQGDEAVAAAAGNPIPAAAGVQPAGGVPPPAPTAVVDGNQARADV------NVAGGQ 394
Fly 395 ALPPNFADLFGDASGLPNGLPNLAGLQIPPPPV-MPMISPFMIPPHFGYLTPLPPPPIPQDLTNF 458
Fly 459 TDEELRAMEGL 469 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sip3 | NP_001263152.1 | HRD1 | 20..>365 | CDD:227568 | 26/93 (28%) |
zf-RING_2 | 287..328 | CDD:290367 | 16/41 (39%) | ||
Chfr | XP_006249597.1 | FHA | 16..105 | CDD:238017 | |
FHA | <27..140 | CDD:224630 | |||
RING | 302..345 | CDD:238093 | 18/43 (42%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5243 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |