DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sip3 and RNF139

DIOPT Version :9

Sequence 1:NP_001263152.1 Gene:sip3 / 43747 FlyBaseID:FBgn0039875 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_009149.2 Gene:RNF139 / 11236 HGNCID:17023 Length:664 Species:Homo sapiens


Alignment Length:385 Identity:97/385 - (25%)
Similarity:148/385 - (38%) Gaps:87/385 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQLLLSSVCMALTSAVIGFAYYQKQQFYPAVVYITKSNASMG-VIYIQFFVIVFMFGKLLSKIFL 64
            |..::|||...|...::.|           :....:.:..:| |..:.||::....|       |
Human   294 MSAVISSVAHYLGLGILAF-----------IGSTEEDDRRLGFVAPVLFFILALQTG-------L 340

  Fly    65 GTLRAAEFEHLLERFWYALTETCLAFTVFRDDFNPRFVALFT--VLLFLKSFHWLAEERVDFMER 127
            ..||..|....|.|      ..||..|...     .|:...|  ||:.|.:.|..:     |...
Human   341 SGLRPEERLIRLSR------NMCLLLTAVL-----HFIHGMTDPVLMSLSASHVSS-----FRRH 389

  Fly   128 SPVLGWLFHIRVGSLLTVLGI-LDYVLLIH-AYNSTLVRGPTVQLVFGFEYAILLTVIASTAIKY 190
            .|||      .|.:.|.:|.: |.|||..| |.|:.|.      .|..|...:.|.||.|..: |
Human   390 FPVL------FVSACLFILPVLLSYVLWHHYALNTWLF------AVTAFCVELCLKVIVSLTV-Y 441

  Fly   191 VLHAAEMRTDTPWENKAVFLLYTELVIGLIKVVLYILFVVIM-------------AKIYALPMFV 242
            .|...:...:..||....::.|......:|:    .:|.|:|             :||.|..|.:
Human   442 TLFMIDGYYNVLWEKLDDYVYYVRSTGSIIE----FIFGVVMFGNGAYTMMFESGSKIRAFMMCL 502

  Fly   243 FRPMFFTIRNFRKALN--DVIMSRR-AIRNMNTLYPDATPEELRQSDNICIICREDMVNHSKKLP 304
            .  .:|.|  :.:|.|  ...|:|| |::.:|:| |:.....|::.:::|.||..:....::..|
Human   503 H--AYFNI--YLQAKNGWKTFMNRRTAVKKINSL-PEIKGSRLQEINDVCAICYHEFTTSARITP 562

  Fly   305 CGHIFHTTCLRSWFQRQQTCPTCRLNILRTPTV--NSTAMPRQG--------DEAVAAAA 354
            |.|.||..|||.|...|.|||.|...:.....:  ||......|        :|||..||
Human   563 CNHYFHALCLRKWLYIQDTCPMCHQKVYIEDDIKDNSNVSNNNGFIPPNETPEEAVREAA 622

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sip3NP_001263152.1 HRD1 20..>365 CDD:227568 91/366 (25%)
zf-RING_2 287..328 CDD:290367 16/40 (40%)
RNF139NP_009149.2 TRC8_N 19..516 CDD:316245 64/276 (23%)
RING-H2_RNF139 545..586 CDD:319597 16/40 (40%)
RING-H2 finger (C3H2C3-type) 547..585 CDD:319597 16/37 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 601..664 6/22 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5243
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D897451at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6571
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.